Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | GL186_RS10845 | Genome accession | NZ_CP046358 |
| Coordinates | 2118878..2119003 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae strain 566 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2113878..2124003
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GL186_RS11430 | - | 2114216..2115819 (-) | 1604 | Protein_2113 | YhgE/Pip family protein | - |
| GL186_RS10820 (GL186_11010) | - | 2115998..2116540 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| GL186_RS10835 (GL186_11025) | comE | 2116783..2117535 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| GL186_RS10840 (GL186_11030) | comD/comD2 | 2117532..2118857 (-) | 1326 | WP_024477997.1 | competence system sensor histidine kinase ComD | Regulator |
| GL186_RS10845 (GL186_11035) | comC/comC2 | 2118878..2119003 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| GL186_RS10855 (GL186_11045) | rlmH | 2119285..2119764 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| GL186_RS10860 (GL186_11050) | htrA | 2119947..2121128 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| GL186_RS10865 (GL186_11055) | spo0J | 2121186..2121944 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
| GL186_RS10870 (GL186_11060) | dnaA | 2122157..2123518 (+) | 1362 | WP_000660615.1 | chromosomal replication initiator protein DnaA | - |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=403300 GL186_RS10845 WP_000799694.1 2118878..2119003(-) (comC/comC2) [Streptococcus pneumoniae strain 566]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=403300 GL186_RS10845 WP_000799694.1 2118878..2119003(-) (comC/comC2) [Streptococcus pneumoniae strain 566]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |