Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SA08028_RS10920 | Genome accession | NZ_CP045435 |
| Coordinates | 2159411..2159881 (-) | Length | 156 a.a. |
| NCBI ID | WP_000934764.1 | Uniprot ID | A0A9P4DKA4 |
| Organism | Staphylococcus aureus strain 08-028 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2129796..2186199 | 2159411..2159881 | within | 0 |
Gene organization within MGE regions
Location: 2129796..2186199
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA08028_RS10705 (SA08028_03114) | scn | 2129796..2130146 (-) | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| SA08028_RS10710 (SA08028_03115) | - | 2130656..2130994 (-) | 339 | Protein_2091 | SH3 domain-containing protein | - |
| SA08028_RS10715 (SA08028_01647) | sak | 2131642..2132133 (-) | 492 | WP_000920038.1 | staphylokinase | - |
| SA08028_RS10720 (SA08028_01648) | - | 2132323..2133078 (-) | 756 | WP_031763770.1 | CHAP domain-containing protein | - |
| SA08028_RS10725 (SA08028_03116) | - | 2133090..2133344 (-) | 255 | WP_000611512.1 | phage holin | - |
| SA08028_RS10730 | - | 2133396..2133503 (+) | 108 | WP_031762631.1 | hypothetical protein | - |
| SA08028_RS10735 (SA08028_03117) | pepG1 | 2133556..2133690 (-) | 135 | WP_000880502.1 | type I toxin-antitoxin system toxin PepG1 | - |
| SA08028_RS10740 (SA08028_01649) | - | 2133875..2134249 (-) | 375 | WP_000340977.1 | hypothetical protein | - |
| SA08028_RS10745 (SA08028_03118) | - | 2134305..2134592 (-) | 288 | WP_001262620.1 | hypothetical protein | - |
| SA08028_RS10750 (SA08028_03119) | - | 2134638..2134790 (-) | 153 | WP_001000058.1 | hypothetical protein | - |
| SA08028_RS10755 (SA08028_03594) | - | 2134783..2138566 (-) | 3784 | Protein_2100 | phage tail spike protein | - |
| SA08028_RS10760 (SA08028_01653) | - | 2138582..2140072 (-) | 1491 | WP_001154327.1 | phage tail domain-containing protein | - |
| SA08028_RS10765 (SA08028_03595) | - | 2140072..2144722 (-) | 4651 | Protein_2102 | phage tail tape measure protein | - |
| SA08028_RS10770 | gpGT | 2144778..2144900 (-) | 123 | WP_000571956.1 | phage tail assembly chaperone GT | - |
| SA08028_RS10775 (SA08028_03121) | gpG | 2144960..2145406 (-) | 447 | WP_000442601.1 | phage tail assembly chaperone G | - |
| SA08028_RS10780 (SA08028_01656) | - | 2145471..2146424 (-) | 954 | WP_000570652.1 | major tail protein | - |
| SA08028_RS10785 (SA08028_03122) | - | 2146425..2146805 (-) | 381 | WP_000611449.1 | hypothetical protein | - |
| SA08028_RS10790 (SA08028_03123) | - | 2146802..2147179 (-) | 378 | WP_000501244.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SA08028_RS10795 (SA08028_03124) | - | 2147179..2147514 (-) | 336 | WP_000975314.1 | head-tail adaptor protein | - |
| SA08028_RS10800 (SA08028_03125) | - | 2147501..2147833 (-) | 333 | WP_001177489.1 | head-tail connector protein | - |
| SA08028_RS10805 (SA08028_03126) | - | 2147842..2148000 (-) | 159 | WP_001252099.1 | hypothetical protein | - |
| SA08028_RS10810 (SA08028_01657) | - | 2148036..2149283 (-) | 1248 | WP_000849958.1 | phage major capsid protein | - |
| SA08028_RS10815 (SA08028_01658) | - | 2149371..2149955 (-) | 585 | WP_000032523.1 | HK97 family phage prohead protease | - |
| SA08028_RS10820 (SA08028_01659) | - | 2149948..2151198 (-) | 1251 | WP_000511064.1 | phage portal protein | - |
| SA08028_RS10825 (SA08028_03127) | - | 2151204..2151404 (-) | 201 | WP_000365301.1 | hypothetical protein | - |
| SA08028_RS10830 (SA08028_01660) | - | 2151418..2153112 (-) | 1695 | WP_031879888.1 | terminase large subunit | - |
| SA08028_RS10835 (SA08028_03128) | - | 2153115..2153582 (-) | 468 | WP_000919026.1 | phage terminase small subunit P27 family | - |
| SA08028_RS10840 (SA08028_03129) | - | 2153710..2154054 (-) | 345 | WP_000817289.1 | HNH endonuclease | - |
| SA08028_RS10845 (SA08028_03130) | - | 2154070..2154522 (-) | 453 | WP_000406191.1 | nucleoside triphosphate pyrophosphohydrolase family protein | - |
| SA08028_RS10850 (SA08028_01663) | - | 2154637..2155107 (-) | 471 | WP_179976074.1 | hypothetical protein | - |
| SA08028_RS10855 (SA08028_03131) | - | 2155130..2155330 (-) | 201 | WP_000265041.1 | DUF1514 family protein | - |
| SA08028_RS10860 (SA08028_03132) | rinB | 2155330..2155479 (-) | 150 | WP_179976075.1 | transcriptional activator RinB | - |
| SA08028_RS10865 (SA08028_03133) | - | 2155476..2155862 (-) | 387 | WP_000592207.1 | hypothetical protein | - |
| SA08028_RS10870 (SA08028_03134) | - | 2155859..2156065 (-) | 207 | WP_000195803.1 | DUF1381 domain-containing protein | - |
| SA08028_RS10875 (SA08028_01664) | - | 2156102..2156644 (-) | 543 | WP_000185659.1 | dUTP diphosphatase | - |
| SA08028_RS10880 (SA08028_03135) | - | 2156637..2156819 (-) | 183 | WP_000028422.1 | hypothetical protein | - |
| SA08028_RS10885 (SA08028_01665) | - | 2156809..2157060 (-) | 252 | WP_001065091.1 | DUF1024 family protein | - |
| SA08028_RS10890 (SA08028_03136) | - | 2157053..2157220 (-) | 168 | WP_001624242.1 | hypothetical protein | - |
| SA08028_RS10895 (SA08028_03137) | - | 2157232..2157474 (-) | 243 | WP_000131366.1 | SAV1978 family virulence-associated passenger protein | - |
| SA08028_RS10900 (SA08028_03138) | - | 2157478..2157846 (-) | 369 | WP_000101274.1 | SA1788 family PVL leukocidin-associated protein | - |
| SA08028_RS10905 (SA08028_03139) | - | 2157859..2158263 (-) | 405 | WP_000401960.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SA08028_RS10910 (SA08028_03140) | - | 2158272..2158490 (-) | 219 | WP_000338530.1 | hypothetical protein | - |
| SA08028_RS10915 (SA08028_01666) | - | 2158497..2159381 (-) | 885 | WP_000148316.1 | DnaD domain protein | - |
| SA08028_RS10920 (SA08028_03141) | ssbA | 2159411..2159881 (-) | 471 | WP_000934764.1 | single-stranded DNA-binding protein | Machinery gene |
| SA08028_RS10925 (SA08028_01667) | - | 2159882..2160499 (-) | 618 | WP_071621397.1 | MBL fold metallo-hydrolase | - |
| SA08028_RS10930 (SA08028_01668) | - | 2160580..2161500 (-) | 921 | WP_000138472.1 | recombinase RecT | - |
| SA08028_RS10935 (SA08028_03142) | - | 2161502..2163445 (-) | 1944 | WP_000700577.1 | AAA family ATPase | - |
| SA08028_RS10940 (SA08028_03143) | - | 2163454..2163717 (-) | 264 | WP_001205732.1 | hypothetical protein | - |
| SA08028_RS10945 (SA08028_03144) | - | 2163726..2163986 (-) | 261 | WP_000291503.1 | DUF1108 family protein | - |
| SA08028_RS10950 (SA08028_03145) | - | 2163967..2164293 (-) | 327 | WP_000165375.1 | DUF2482 family protein | - |
| SA08028_RS10955 (SA08028_03146) | - | 2164388..2164549 (-) | 162 | WP_000066017.1 | DUF1270 domain-containing protein | - |
| SA08028_RS10960 (SA08028_03147) | - | 2164546..2164866 (-) | 321 | WP_001120197.1 | DUF771 domain-containing protein | - |
| SA08028_RS10965 (SA08028_03148) | - | 2164925..2165557 (+) | 633 | WP_000275058.1 | hypothetical protein | - |
| SA08028_RS10970 (SA08028_03149) | - | 2165572..2165712 (-) | 141 | WP_000939496.1 | hypothetical protein | - |
| SA08028_RS10975 (SA08028_03150) | - | 2165743..2165940 (-) | 198 | WP_001148855.1 | hypothetical protein | - |
| SA08028_RS10980 (SA08028_01672) | - | 2165956..2166708 (-) | 753 | WP_001148605.1 | phage antirepressor KilAC domain-containing protein | - |
| SA08028_RS10985 (SA08028_03151) | - | 2166759..2167088 (+) | 330 | WP_000128907.1 | hypothetical protein | - |
| SA08028_RS10990 (SA08028_03152) | - | 2167077..2167292 (-) | 216 | WP_001025874.1 | MW1434 family type I TA system toxin | - |
| SA08028_RS10995 (SA08028_03153) | - | 2167308..2167571 (-) | 264 | WP_000854072.1 | helix-turn-helix transcriptional regulator | - |
| SA08028_RS11000 | - | 2167568..2167741 (-) | 174 | WP_001801500.1 | hypothetical protein | - |
| SA08028_RS11005 (SA08028_01673) | - | 2167704..2168417 (+) | 714 | WP_001031454.1 | XRE family transcriptional regulator | - |
| SA08028_RS11010 (SA08028_01674) | - | 2168433..2169365 (+) | 933 | WP_000759682.1 | exonuclease domain-containing protein | - |
| SA08028_RS11015 (SA08028_03154) | - | 2169371..2169712 (+) | 342 | WP_000591749.1 | hypothetical protein | - |
| SA08028_RS11020 (SA08028_03155) | - | 2169916..2170098 (+) | 183 | WP_000705246.1 | hypothetical protein | - |
| SA08028_RS11025 (SA08028_03156) | - | 2170134..2170280 (+) | 147 | WP_001013104.1 | hypothetical protein | - |
| SA08028_RS11030 (SA08028_03602) | - | 2170277..2170893 (-) | 617 | Protein_2155 | ATPase | - |
| SA08028_RS11035 (SA08028_01675) | - | 2171001..2172038 (+) | 1038 | WP_000857176.1 | site-specific integrase | - |
| SA08028_RS11040 (SA08028_01676) | sph | 2172095..2172919 (+) | 825 | Protein_2157 | sphingomyelin phosphodiesterase | - |
| SA08028_RS11045 (SA08028_01677) | lukG | 2173157..2174173 (-) | 1017 | WP_000595401.1 | bi-component leukocidin LukGH subunit G | - |
| SA08028_RS11050 (SA08028_01678) | lukH | 2174195..2175247 (-) | 1053 | WP_000791417.1 | bi-component leukocidin LukGH subunit H | - |
| SA08028_RS11055 (SA08028_01679) | - | 2175682..2176905 (+) | 1224 | WP_000206623.1 | ArgE/DapE family deacylase | - |
| SA08028_RS11060 (SA08028_03596) | - | 2177277..2178123 (-) | 847 | Protein_2161 | class I SAM-dependent methyltransferase | - |
| SA08028_RS11065 (SA08028_01681) | - | 2178185..2179097 (-) | 913 | Protein_2162 | iron-hydroxamate ABC transporter substrate-binding protein | - |
| SA08028_RS11070 (SA08028_01682) | - | 2179258..2180565 (+) | 1308 | WP_001045079.1 | TrkH family potassium uptake protein | - |
| SA08028_RS11075 (SA08028_03158) | - | 2181419..2181862 (-) | 444 | WP_000022887.1 | GNAT family N-acetyltransferase | - |
| SA08028_RS11080 (SA08028_01683) | - | 2181968..2182405 (-) | 438 | WP_072419900.1 | hypothetical protein | - |
| SA08028_RS11085 (SA08028_01684) | - | 2182722..2183312 (-) | 591 | WP_001293059.1 | terminase small subunit | - |
| SA08028_RS11090 (SA08028_03159) | - | 2183309..2183521 (-) | 213 | WP_000128898.1 | LuxR C-terminal-related transcriptional regulator | - |
| SA08028_RS11095 | - | 2183582..2184128 (+) | 547 | Protein_2168 | site-specific integrase | - |
| SA08028_RS11100 (SA08028_03160) | groL | 2184223..2185839 (-) | 1617 | WP_000240642.1 | chaperonin GroEL | - |
| SA08028_RS11105 (SA08028_01686) | groES | 2185915..2186199 (-) | 285 | WP_000917289.1 | co-chaperone GroES | - |
Sequence
Protein
Download Length: 156 a.a. Molecular weight: 17627.49 Da Isoelectric Point: 5.2672
>NTDB_id=394120 SA08028_RS10920 WP_000934764.1 2159411..2159881(-) (ssbA) [Staphylococcus aureus strain 08-028]
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
MLNRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVVADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF
Nucleotide
Download Length: 471 bp
>NTDB_id=394120 SA08028_RS10920 WP_000934764.1 2159411..2159881(-) (ssbA) [Staphylococcus aureus strain 08-028]
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
ATGCTAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGAACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGGCGGGCGTAGATGGTAGGTTACAAACGCGG
AACTATGAAAATAAGGAAGGTCAACGTGTATACGTTACGGAAGTTGTTGCCGATAGTATTCAATTTTTAGAACCGAAGAA
CTCAAATGACACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGACAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCGAATGCAAATGGTCCGATTGAACTAAATGATGATGATTTACCATTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.932 |
100 |
0.635 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.558 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
67.949 |
0.404 |
| ssb | Neisseria meningitidis MC58 |
33.526 |
100 |
0.372 |
| ssb | Neisseria gonorrhoeae MS11 |
33.526 |
100 |
0.372 |
| ssb | Glaesserella parasuis strain SC1401 |
32.768 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
31.492 |
100 |
0.365 |