Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FOB76_RS06605 | Genome accession | NZ_CP044093 |
| Coordinates | 1264356..1264535 (+) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain FDAARGOS_668 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1223918..1264535 | 1264356..1264535 | within | 0 |
Gene organization within MGE regions
Location: 1223918..1264535
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOB76_RS06355 (FOB76_06355) | - | 1223918..1224997 (-) | 1080 | WP_002988667.1 | site-specific integrase | - |
| FOB76_RS06360 (FOB76_06360) | - | 1225114..1225665 (-) | 552 | WP_002988670.1 | hypothetical protein | - |
| FOB76_RS06365 (FOB76_06365) | - | 1225676..1226059 (-) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FOB76_RS06370 (FOB76_06370) | - | 1226073..1226423 (-) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| FOB76_RS09490 | - | 1226749..1226901 (+) | 153 | WP_011527730.1 | hypothetical protein | - |
| FOB76_RS06375 (FOB76_06375) | - | 1226886..1227299 (-) | 414 | WP_032461522.1 | hypothetical protein | - |
| FOB76_RS06380 (FOB76_06380) | - | 1227347..1227562 (+) | 216 | WP_002988684.1 | hypothetical protein | - |
| FOB76_RS06385 (FOB76_06385) | - | 1227624..1227899 (+) | 276 | WP_002988687.1 | hypothetical protein | - |
| FOB76_RS06390 (FOB76_06390) | - | 1227896..1228066 (+) | 171 | WP_002988693.1 | hypothetical protein | - |
| FOB76_RS06395 (FOB76_06395) | - | 1228059..1228262 (+) | 204 | WP_002988697.1 | hypothetical protein | - |
| FOB76_RS06400 (FOB76_06400) | - | 1228259..1228645 (+) | 387 | WP_002988700.1 | hypothetical protein | - |
| FOB76_RS06405 (FOB76_06405) | - | 1228791..1228994 (+) | 204 | WP_002988705.1 | hypothetical protein | - |
| FOB76_RS06410 (FOB76_06410) | - | 1229082..1229381 (+) | 300 | WP_002988708.1 | hypothetical protein | - |
| FOB76_RS06415 (FOB76_06415) | - | 1229381..1230535 (+) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| FOB76_RS06420 (FOB76_06420) | - | 1230539..1230937 (+) | 399 | WP_002988715.1 | hypothetical protein | - |
| FOB76_RS06425 (FOB76_06425) | - | 1230948..1231505 (+) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| FOB76_RS06430 (FOB76_06430) | - | 1231548..1233470 (+) | 1923 | WP_002988723.1 | DNA polymerase | - |
| FOB76_RS06435 (FOB76_06435) | - | 1233475..1235859 (+) | 2385 | WP_123949447.1 | phage/plasmid primase, P4 family | - |
| FOB76_RS06440 (FOB76_06440) | - | 1236246..1236521 (+) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| FOB76_RS06445 (FOB76_06445) | - | 1236518..1237840 (+) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| FOB76_RS09495 | - | 1237841..1238008 (+) | 168 | WP_002988735.1 | hypothetical protein | - |
| FOB76_RS06450 (FOB76_06450) | - | 1238005..1238271 (+) | 267 | WP_002988738.1 | hypothetical protein | - |
| FOB76_RS06455 (FOB76_06455) | - | 1238280..1239131 (+) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| FOB76_RS06460 (FOB76_06460) | - | 1239121..1239312 (+) | 192 | WP_002988743.1 | hypothetical protein | - |
| FOB76_RS06465 (FOB76_06465) | - | 1239309..1239725 (+) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| FOB76_RS06470 (FOB76_06470) | - | 1239815..1240267 (+) | 453 | WP_011106637.1 | terminase small subunit | - |
| FOB76_RS06475 (FOB76_06475) | - | 1240257..1241534 (+) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| FOB76_RS06480 (FOB76_06480) | - | 1241550..1243082 (+) | 1533 | WP_002988758.1 | phage portal protein | - |
| FOB76_RS06485 (FOB76_06485) | - | 1243042..1244487 (+) | 1446 | WP_015446273.1 | minor capsid protein | - |
| FOB76_RS06490 (FOB76_06490) | - | 1244518..1244706 (+) | 189 | WP_002983423.1 | hypothetical protein | - |
| FOB76_RS06495 (FOB76_06495) | - | 1244709..1244975 (+) | 267 | WP_002988765.1 | hypothetical protein | - |
| FOB76_RS06500 (FOB76_06500) | - | 1245131..1245700 (+) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| FOB76_RS06505 (FOB76_06505) | - | 1245713..1246600 (+) | 888 | WP_002988771.1 | hypothetical protein | - |
| FOB76_RS06510 (FOB76_06510) | - | 1246612..1246968 (+) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| FOB76_RS06515 (FOB76_06515) | - | 1246979..1247257 (+) | 279 | WP_000639437.1 | hypothetical protein | - |
| FOB76_RS06520 (FOB76_06520) | - | 1247254..1247598 (+) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FOB76_RS06525 (FOB76_06525) | - | 1247602..1247961 (+) | 360 | WP_002988782.1 | hypothetical protein | - |
| FOB76_RS06530 (FOB76_06530) | - | 1247973..1248572 (+) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| FOB76_RS06535 (FOB76_06535) | - | 1248626..1249081 (+) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| FOB76_RS06540 (FOB76_06540) | - | 1249156..1249389 (+) | 234 | WP_002983445.1 | hypothetical protein | - |
| FOB76_RS06545 (FOB76_06545) | - | 1249404..1253786 (+) | 4383 | WP_002988786.1 | tape measure protein | - |
| FOB76_RS06550 (FOB76_06550) | - | 1253798..1254640 (+) | 843 | WP_002988788.1 | phage tail family protein | - |
| FOB76_RS06555 (FOB76_06555) | - | 1254650..1256632 (+) | 1983 | WP_002988790.1 | phage tail protein | - |
| FOB76_RS06560 (FOB76_06560) | - | 1256629..1257684 (+) | 1056 | WP_002988439.1 | hypothetical protein | - |
| FOB76_RS06565 (FOB76_06565) | - | 1257684..1258319 (+) | 636 | WP_002988442.1 | hypothetical protein | - |
| FOB76_RS06570 (FOB76_06570) | - | 1258330..1260237 (+) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| FOB76_RS06575 (FOB76_06575) | - | 1260246..1260407 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| FOB76_RS06580 (FOB76_06580) | - | 1260410..1261030 (+) | 621 | WP_002988797.1 | hypothetical protein | - |
| FOB76_RS06585 (FOB76_06585) | - | 1261041..1261340 (+) | 300 | WP_002988799.1 | hypothetical protein | - |
| FOB76_RS06590 (FOB76_06590) | - | 1261337..1261522 (+) | 186 | WP_002988802.1 | holin | - |
| FOB76_RS06595 (FOB76_06595) | - | 1261633..1262829 (+) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| FOB76_RS06600 (FOB76_06600) | sda1 | 1262945..1264117 (-) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| FOB76_RS06605 (FOB76_06605) | prx | 1264356..1264535 (+) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=387761 FOB76_RS06605 WP_002988813.1 1264356..1264535(+) (prx) [Streptococcus pyogenes strain FDAARGOS_668]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=387761 FOB76_RS06605 WP_002988813.1 1264356..1264535(+) (prx) [Streptococcus pyogenes strain FDAARGOS_668]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |