Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS2221_RS05895 | Genome accession | NZ_CP043530 |
| Coordinates | 1169056..1169238 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS2221 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1169056..1204066 | 1169056..1169238 | within | 0 |
Gene organization within MGE regions
Location: 1169056..1204066
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS2221_RS05895 (MGAS2221_1178) | prx | 1169056..1169238 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| MGAS2221_RS05900 (MGAS2221_1179) | sda3 | 1169477..1170277 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| MGAS2221_RS05905 (MGAS2221_1180) | - | 1170548..1170982 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| MGAS2221_RS05910 (MGAS2221_1181) | - | 1171052..1172257 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| MGAS2221_RS05915 (MGAS2221_1182) | - | 1172373..1172600 (-) | 228 | WP_003058873.1 | phage holin | - |
| MGAS2221_RS05920 (MGAS2221_1183) | - | 1172597..1172872 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| MGAS2221_RS05925 (MGAS2221_1184) | - | 1172882..1173499 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| MGAS2221_RS05930 (MGAS2221_1185) | - | 1173496..1173933 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| MGAS2221_RS05935 (MGAS2221_1186) | - | 1173945..1175813 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| MGAS2221_RS05940 (MGAS2221_1187) | - | 1175810..1176505 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| MGAS2221_RS05945 (MGAS2221_1188) | - | 1176502..1178859 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| MGAS2221_RS05950 (MGAS2221_1189) | - | 1178859..1179230 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| MGAS2221_RS05955 (MGAS2221_1190) | - | 1179245..1179508 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| MGAS2221_RS05960 (MGAS2221_1191) | - | 1179519..1180112 (-) | 594 | WP_010922456.1 | tail protein | - |
| MGAS2221_RS05965 (MGAS2221_1192) | - | 1180124..1180459 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| MGAS2221_RS05970 (MGAS2221_1193) | - | 1180460..1180696 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| MGAS2221_RS05975 (MGAS2221_1194) | - | 1180689..1181027 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| MGAS2221_RS05980 (MGAS2221_1195) | - | 1180987..1181409 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| MGAS2221_RS05985 (MGAS2221_1196) | - | 1181419..1181619 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| MGAS2221_RS05990 (MGAS2221_1197) | - | 1181619..1182530 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| MGAS2221_RS05995 (MGAS2221_1198) | - | 1182555..1183016 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| MGAS2221_RS06000 (MGAS2221_1199) | - | 1183097..1184512 (-) | 1416 | WP_011285619.1 | terminase | - |
| MGAS2221_RS06005 (MGAS2221_1200) | - | 1184622..1184888 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| MGAS2221_RS06010 (MGAS2221_1201) | - | 1184881..1185060 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| MGAS2221_RS06015 (MGAS2221_1202) | - | 1185110..1185334 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| MGAS2221_RS06020 (MGAS2221_1203) | - | 1185340..1186833 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| MGAS2221_RS06025 (MGAS2221_1204) | - | 1186826..1188094 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| MGAS2221_RS06030 (MGAS2221_1205) | - | 1188091..1188447 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| MGAS2221_RS06035 | - | 1188596..1188940 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| MGAS2221_RS06040 (MGAS2221_1206) | - | 1189049..1189468 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| MGAS2221_RS06045 (MGAS2221_1207) | - | 1189736..1190371 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| MGAS2221_RS06050 (MGAS2221_1208) | - | 1190373..1190642 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| MGAS2221_RS06055 (MGAS2221_1209) | - | 1190726..1191238 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| MGAS2221_RS06060 (MGAS2221_1210) | - | 1191235..1191576 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| MGAS2221_RS06065 (MGAS2221_1211) | - | 1191754..1191921 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| MGAS2221_RS06070 (MGAS2221_1212) | - | 1191931..1192728 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| MGAS2221_RS06075 (MGAS2221_1213) | - | 1192725..1193654 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| MGAS2221_RS06080 (MGAS2221_1214) | - | 1193657..1193986 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| MGAS2221_RS06085 (MGAS2221_1215) | - | 1194042..1194248 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| MGAS2221_RS06090 (MGAS2221_1216) | - | 1194257..1194397 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| MGAS2221_RS06095 (MGAS2221_1217) | - | 1194394..1194627 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| MGAS2221_RS06100 (MGAS2221_1218) | - | 1194608..1194997 (-) | 390 | WP_011285627.1 | DnaD domain protein | - |
| MGAS2221_RS09360 | - | 1195142..1195381 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| MGAS2221_RS06105 (MGAS2221_1219) | - | 1195481..1195666 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| MGAS2221_RS06110 (MGAS2221_1220) | - | 1195668..1195979 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| MGAS2221_RS06115 (MGAS2221_1221) | - | 1196057..1196242 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| MGAS2221_RS06120 (MGAS2221_1222) | - | 1196409..1196648 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| MGAS2221_RS06125 (MGAS2221_1223) | - | 1196790..1197596 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| MGAS2221_RS06130 (MGAS2221_1224) | - | 1197531..1197797 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| MGAS2221_RS06135 (MGAS2221_1225) | - | 1197829..1198545 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| MGAS2221_RS06140 (MGAS2221_1226) | - | 1198557..1198748 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| MGAS2221_RS06145 | - | 1199384..1199479 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| MGAS2221_RS06150 (MGAS2221_1228) | - | 1199902..1200249 (+) | 348 | WP_011285631.1 | helix-turn-helix transcriptional regulator | - |
| MGAS2221_RS06155 (MGAS2221_1229) | - | 1200253..1200633 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| MGAS2221_RS06160 (MGAS2221_1230) | - | 1200645..1200911 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| MGAS2221_RS06165 (MGAS2221_1231) | - | 1201035..1202177 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| MGAS2221_RS06170 (MGAS2221_1232) | - | 1202267..1202542 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| MGAS2221_RS06175 (MGAS2221_1233) | - | 1202641..1203228 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| MGAS2221_RS06180 (MGAS2221_1234) | - | 1203206..1204048 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=384847 MGAS2221_RS05895 WP_011017964.1 1169056..1169238(-) (prx) [Streptococcus pyogenes strain MGAS2221]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=384847 MGAS2221_RS05895 WP_011017964.1 1169056..1169238(-) (prx) [Streptococcus pyogenes strain MGAS2221]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |