Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | MGAS2221_RS05070 | Genome accession | NZ_CP043530 |
| Coordinates | 1007315..1007503 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain MGAS2221 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 999731..1046041 | 1007315..1007503 | within | 0 |
Gene organization within MGE regions
Location: 999731..1046041
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MGAS2221_RS05035 (MGAS2221_1001) | pfkA | 999731..1000744 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| MGAS2221_RS05040 (MGAS2221_1002) | - | 1000824..1003934 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| MGAS2221_RS05045 (MGAS2221_1003) | - | 1004119..1004490 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| MGAS2221_RS05050 (MGAS2221_1004) | - | 1004490..1005188 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| MGAS2221_RS05055 (MGAS2221_1005) | - | 1005198..1005983 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| MGAS2221_RS05060 (MGAS2221_1006) | - | 1006110..1006724 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| MGAS2221_RS05070 (MGAS2221_1008) | prx | 1007315..1007503 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| MGAS2221_RS05075 (MGAS2221_1009) | speA | 1007723..1008478 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| MGAS2221_RS05080 (MGAS2221_1010) | - | 1008600..1009259 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| MGAS2221_RS05085 (MGAS2221_1011) | - | 1009259..1009480 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| MGAS2221_RS05090 (MGAS2221_1012) | - | 1009490..1010263 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| MGAS2221_RS05095 (MGAS2221_1013) | - | 1010274..1010876 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| MGAS2221_RS05100 (MGAS2221_1014) | - | 1010888..1011652 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| MGAS2221_RS05105 (MGAS2221_1015) | - | 1011654..1011986 (-) | 333 | WP_011285562.1 | phage holin | - |
| MGAS2221_RS05110 (MGAS2221_1016) | - | 1011986..1012309 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| MGAS2221_RS09420 (MGAS2221_1017) | - | 1012323..1012445 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| MGAS2221_RS05115 (MGAS2221_1018) | - | 1012459..1012806 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| MGAS2221_RS05120 (MGAS2221_1019) | - | 1012817..1014679 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| MGAS2221_RS05125 (MGAS2221_1020) | - | 1014684..1018124 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| MGAS2221_RS05130 (MGAS2221_1021) | - | 1018125..1019609 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| MGAS2221_RS05135 (MGAS2221_1022) | - | 1019610..1021415 (-) | 1806 | WP_011054802.1 | tail protein | - |
| MGAS2221_RS05140 (MGAS2221_1023) | - | 1021408..1021866 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| MGAS2221_RS05145 (MGAS2221_1024) | - | 1021839..1022156 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| MGAS2221_RS05150 (MGAS2221_1025) | - | 1022169..1022675 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| MGAS2221_RS05155 (MGAS2221_1026) | - | 1022687..1023097 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| MGAS2221_RS05160 (MGAS2221_1027) | - | 1023099..1023494 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| MGAS2221_RS05165 (MGAS2221_1028) | - | 1023491..1023802 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| MGAS2221_RS05170 (MGAS2221_1029) | - | 1023799..1024143 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| MGAS2221_RS05175 (MGAS2221_1030) | - | 1024157..1024450 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| MGAS2221_RS05180 (MGAS2221_1031) | - | 1024463..1025353 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| MGAS2221_RS05185 (MGAS2221_1032) | - | 1025372..1025941 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| MGAS2221_RS09425 (MGAS2221_1033) | - | 1026050..1026184 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| MGAS2221_RS05190 (MGAS2221_1034) | - | 1026186..1026455 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| MGAS2221_RS05195 (MGAS2221_1035) | - | 1026462..1027370 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| MGAS2221_RS05200 (MGAS2221_1036) | - | 1027339..1028664 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| MGAS2221_RS05205 (MGAS2221_1037) | - | 1028664..1029938 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| MGAS2221_RS05210 (MGAS2221_1038) | - | 1029928..1030308 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| MGAS2221_RS05215 (MGAS2221_1039) | - | 1030918..1031352 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| MGAS2221_RS05220 (MGAS2221_1040) | - | 1031638..1031904 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| MGAS2221_RS05225 (MGAS2221_1041) | - | 1031901..1032425 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| MGAS2221_RS05230 (MGAS2221_1042) | - | 1032428..1033060 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| MGAS2221_RS05235 (MGAS2221_1043) | - | 1033062..1033346 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| MGAS2221_RS05240 (MGAS2221_1044) | - | 1033343..1033513 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| MGAS2221_RS05245 (MGAS2221_1045) | - | 1033510..1033746 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| MGAS2221_RS09460 (MGAS2221_1046) | - | 1033746..1033991 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| MGAS2221_RS05250 (MGAS2221_1047) | - | 1033988..1034344 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| MGAS2221_RS05255 (MGAS2221_1048) | - | 1034341..1034781 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| MGAS2221_RS05260 | - | 1034781..1034984 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| MGAS2221_RS05265 (MGAS2221_1049) | ssb | 1034990..1035415 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| MGAS2221_RS05270 (MGAS2221_1050) | - | 1035408..1036082 (-) | 675 | WP_011285576.1 | ERF family protein | - |
| MGAS2221_RS05275 (MGAS2221_1051) | - | 1036083..1036565 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| MGAS2221_RS05280 (MGAS2221_1052) | - | 1036587..1036841 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| MGAS2221_RS05285 (MGAS2221_1053) | - | 1036822..1037175 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| MGAS2221_RS05290 (MGAS2221_1055) | - | 1037316..1038098 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| MGAS2221_RS05295 (MGAS2221_1056) | - | 1038085..1038915 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| MGAS2221_RS09345 | - | 1038929..1039117 (-) | 189 | Protein_992 | XRE family transcriptional regulator | - |
| MGAS2221_RS09350 | - | 1039351..1039590 (+) | 240 | WP_227874181.1 | hypothetical protein | - |
| MGAS2221_RS05305 (MGAS2221_1058) | - | 1039721..1039930 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| MGAS2221_RS05310 (MGAS2221_1059) | - | 1040040..1040240 (-) | 201 | WP_002992770.1 | helix-turn-helix transcriptional regulator | - |
| MGAS2221_RS05315 (MGAS2221_1060) | - | 1040314..1040700 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| MGAS2221_RS05320 (MGAS2221_1061) | - | 1040689..1040898 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| MGAS2221_RS05325 (MGAS2221_1062) | - | 1040952..1041551 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| MGAS2221_RS05330 (MGAS2221_1063) | - | 1041581..1041739 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| MGAS2221_RS05335 (MGAS2221_1065) | - | 1042096..1042920 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| MGAS2221_RS05340 (MGAS2221_1066) | - | 1042956..1043849 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| MGAS2221_RS05345 (MGAS2221_1067) | - | 1043970..1045058 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| MGAS2221_RS05350 (MGAS2221_1068) | - | 1045421..1046041 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=384843 MGAS2221_RS05070 WP_011285559.1 1007315..1007503(-) (prx) [Streptococcus pyogenes strain MGAS2221]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=384843 MGAS2221_RS05070 WP_011285559.1 1007315..1007503(-) (prx) [Streptococcus pyogenes strain MGAS2221]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |