Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FNL90_RS03145 | Genome accession | NZ_CP041408 |
| Coordinates | 587615..587797 (+) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain 37-97S | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 537071..587797 | 587615..587797 | within | 0 |
Gene organization within MGE regions
Location: 537071..587797
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNL90_RS02815 (FNL90_02920) | ftsE | 538070..538762 (+) | 693 | WP_002985455.1 | cell division ATP-binding protein FtsE | - |
| FNL90_RS02820 (FNL90_02925) | ftsX | 538755..539684 (+) | 930 | WP_002990498.1 | permease-like cell division protein FtsX | - |
| FNL90_RS02825 (FNL90_02930) | - | 539993..540628 (-) | 636 | WP_002985449.1 | MBL fold metallo-hydrolase | - |
| FNL90_RS02830 (FNL90_02935) | - | 540859..541623 (+) | 765 | WP_002990495.1 | (S)-acetoin forming diacetyl reductase | - |
| FNL90_RS02835 (FNL90_02940) | - | 541773..544232 (+) | 2460 | WP_047235219.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| FNL90_RS02840 (FNL90_02945) | - | 544567..545760 (+) | 1194 | WP_002985439.1 | pyridoxal phosphate-dependent aminotransferase | - |
| FNL90_RS02845 (FNL90_02950) | asnS | 545782..547128 (+) | 1347 | WP_002985437.1 | asparagine--tRNA ligase | - |
| FNL90_RS02850 (FNL90_02955) | rapZ | 547543..548433 (+) | 891 | WP_002985434.1 | RNase adapter RapZ | - |
| FNL90_RS02855 (FNL90_02960) | - | 548430..549407 (+) | 978 | WP_011284642.1 | YvcK family protein | - |
| FNL90_RS02860 (FNL90_02965) | whiA | 549404..550315 (+) | 912 | WP_047235220.1 | DNA-binding protein WhiA | - |
| FNL90_RS02865 (FNL90_02970) | - | 550492..551907 (-) | 1416 | WP_011017563.1 | recombinase family protein | - |
| FNL90_RS02870 (FNL90_02975) | - | 552030..552335 (-) | 306 | WP_002985420.1 | membrane protein | - |
| FNL90_RS02875 (FNL90_02980) | - | 552345..553109 (-) | 765 | WP_002985417.1 | helix-turn-helix transcriptional regulator | - |
| FNL90_RS02880 (FNL90_02985) | - | 553469..553627 (+) | 159 | WP_002985414.1 | hypothetical protein | - |
| FNL90_RS02885 (FNL90_02990) | - | 553726..554367 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| FNL90_RS02890 (FNL90_02995) | - | 554419..554607 (+) | 189 | WP_002985407.1 | helix-turn-helix transcriptional regulator | - |
| FNL90_RS02895 (FNL90_03000) | - | 554656..555417 (+) | 762 | WP_002985404.1 | phage repressor protein/antirepressor Ant | - |
| FNL90_RS09730 | - | 555430..555561 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| FNL90_RS02900 (FNL90_03005) | - | 555558..555740 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| FNL90_RS02905 (FNL90_03010) | - | 555827..555964 (+) | 138 | WP_002985395.1 | BOW99_gp33 family protein | - |
| FNL90_RS02910 (FNL90_03015) | - | 555966..556151 (+) | 186 | WP_002985392.1 | hypothetical protein | - |
| FNL90_RS09735 (FNL90_03020) | - | 556251..556490 (+) | 240 | WP_002985390.1 | hypothetical protein | - |
| FNL90_RS02915 (FNL90_03025) | - | 556649..557035 (+) | 387 | WP_002985388.1 | DnaD domain-containing protein | - |
| FNL90_RS02920 (FNL90_03030) | - | 557016..557249 (+) | 234 | WP_002985387.1 | hypothetical protein | - |
| FNL90_RS02925 (FNL90_03035) | - | 557246..557386 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| FNL90_RS02930 (FNL90_03040) | - | 557395..557601 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| FNL90_RS02935 (FNL90_03045) | - | 557657..557989 (+) | 333 | WP_010922475.1 | hypothetical protein | - |
| FNL90_RS02940 (FNL90_03050) | - | 557989..558978 (+) | 990 | WP_010922474.1 | recombinase RecT | - |
| FNL90_RS02945 (FNL90_03055) | - | 558975..559175 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| FNL90_RS02950 (FNL90_03060) | - | 559168..559965 (+) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| FNL90_RS02955 (FNL90_03065) | - | 560330..560725 (+) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| FNL90_RS02960 (FNL90_03070) | - | 560722..562068 (+) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| FNL90_RS02965 (FNL90_03075) | - | 562095..562412 (+) | 318 | WP_185168156.1 | hypothetical protein | - |
| FNL90_RS02970 (FNL90_03080) | - | 562409..562921 (+) | 513 | WP_011054695.1 | hypothetical protein | - |
| FNL90_RS02975 (FNL90_03085) | - | 562957..563274 (+) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| FNL90_RS02980 | - | 563271..563426 (+) | 156 | WP_011054693.1 | hypothetical protein | - |
| FNL90_RS02985 (FNL90_03090) | - | 563423..563674 (+) | 252 | WP_011054692.1 | hypothetical protein | - |
| FNL90_RS02990 (FNL90_03095) | - | 563750..564169 (+) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| FNL90_RS02995 (FNL90_03100) | - | 564277..564621 (+) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| FNL90_RS03000 (FNL90_03105) | - | 564769..565125 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| FNL90_RS03005 (FNL90_03110) | - | 565122..566390 (+) | 1269 | WP_010922468.1 | phage portal protein | - |
| FNL90_RS03010 (FNL90_03115) | - | 566383..567876 (+) | 1494 | WP_010922467.1 | hypothetical protein | - |
| FNL90_RS03015 (FNL90_03120) | - | 567882..568106 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| FNL90_RS03020 (FNL90_03125) | - | 568158..568424 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| FNL90_RS03025 (FNL90_03130) | - | 568426..568662 (+) | 237 | Protein_552 | hypothetical protein | - |
| FNL90_RS03030 (FNL90_03135) | - | 568744..570159 (+) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| FNL90_RS03035 (FNL90_03140) | - | 570239..570700 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| FNL90_RS03040 (FNL90_03145) | - | 570725..571636 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| FNL90_RS03045 (FNL90_03150) | - | 571636..571836 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| FNL90_RS03050 (FNL90_03155) | - | 571846..572268 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| FNL90_RS03055 (FNL90_03160) | - | 572228..572566 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| FNL90_RS03060 (FNL90_03165) | - | 572559..572795 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| FNL90_RS03065 (FNL90_03170) | - | 572796..573131 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| FNL90_RS03070 (FNL90_03175) | - | 573143..573721 (+) | 579 | WP_014635577.1 | hypothetical protein | - |
| FNL90_RS03075 (FNL90_03180) | - | 573732..573995 (+) | 264 | WP_003047548.1 | hypothetical protein | - |
| FNL90_RS03080 (FNL90_03185) | - | 574010..574381 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| FNL90_RS03085 (FNL90_03190) | - | 574381..576738 (+) | 2358 | WP_011528784.1 | hypothetical protein | - |
| FNL90_RS03090 (FNL90_03195) | - | 576735..577430 (+) | 696 | WP_047235222.1 | hypothetical protein | - |
| FNL90_RS03095 (FNL90_03200) | - | 577412..579388 (+) | 1977 | WP_047235223.1 | phage tail spike protein | - |
| FNL90_RS03100 (FNL90_03205) | hylP | 579385..580500 (+) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| FNL90_RS03105 (FNL90_03210) | - | 580515..582296 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| FNL90_RS03110 (FNL90_03215) | - | 582305..582733 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| FNL90_RS03115 (FNL90_03220) | - | 582736..583368 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| FNL90_RS03120 (FNL90_03225) | - | 583380..583652 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| FNL90_RS03125 (FNL90_03230) | - | 583649..583876 (+) | 228 | WP_003058873.1 | phage holin | - |
| FNL90_RS03130 (FNL90_03235) | - | 583995..585212 (+) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| FNL90_RS03135 (FNL90_03240) | - | 585348..586472 (+) | 1125 | WP_002988467.1 | Fic family protein | - |
| FNL90_RS03140 (FNL90_03245) | entC3 | 586720..587502 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| FNL90_RS03145 (FNL90_03250) | prx | 587615..587797 (+) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=371883 FNL90_RS03145 WP_011528776.1 587615..587797(+) (prx) [Streptococcus pyogenes strain 37-97S]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=371883 FNL90_RS03145 WP_011528776.1 587615..587797(+) (prx) [Streptococcus pyogenes strain 37-97S]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |