Detailed information
Bioinformatically predicted
Overview
| Name | comFC | Type | Machinery gene |
| Locus tag | FLP15_RS13165 | Genome accession | NZ_CP041356 |
| Coordinates | 1771730..1771822 (-) | Length | 30 a.a. |
| NCBI ID | WP_223804765.1 | Uniprot ID | - |
| Organism | Lactococcus protaetiae strain KACC 19320 | ||
| Function | ssDNA transport into the cell (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1766730..1776822
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FLP15_RS08545 (FLP15_08545) | - | 1767138..1767713 (+) | 576 | WP_223804594.1 | nucleotidyltransferase family protein | - |
| FLP15_RS08550 (FLP15_08550) | - | 1767819..1768697 (-) | 879 | WP_142766771.1 | hypothetical protein | - |
| FLP15_RS08555 (FLP15_08555) | - | 1768922..1769908 (+) | 987 | WP_142767477.1 | ATP-binding cassette domain-containing protein | - |
| FLP15_RS08560 (FLP15_08560) | - | 1769910..1770758 (+) | 849 | WP_223804595.1 | ABC-2 family transporter protein | - |
| FLP15_RS08565 (FLP15_08565) | - | 1770783..1771568 (+) | 786 | WP_142766772.1 | ABC-2 family transporter protein | - |
| FLP15_RS13165 | comFC | 1771730..1771822 (-) | 93 | WP_223804765.1 | hypothetical protein | Machinery gene |
| FLP15_RS08570 (FLP15_08570) | - | 1771831..1772376 (-) | 546 | WP_223804596.1 | ComF family protein | - |
| FLP15_RS08575 (FLP15_08575) | comFA | 1772373..1773644 (-) | 1272 | WP_142766773.1 | DEAD/DEAH box helicase | Machinery gene |
| FLP15_RS12765 | - | 1773777..1775513 (+) | 1737 | WP_190288277.1 | hypothetical protein | - |
| FLP15_RS08585 (FLP15_08585) | - | 1775872..1776507 (+) | 636 | WP_142766774.1 | YigZ family protein | - |
Sequence
Protein
Download Length: 30 a.a. Molecular weight: 3378.91 Da Isoelectric Point: 9.2393
>NTDB_id=371511 FLP15_RS13165 WP_223804765.1 1771730..1771822(-) (comFC) [Lactococcus protaetiae strain KACC 19320]
MYTTGATLQHATHLLKDSGVREIKTFSLCR
MYTTGATLQHATHLLKDSGVREIKTFSLCR
Nucleotide
Download Length: 93 bp
>NTDB_id=371511 FLP15_RS13165 WP_223804765.1 1771730..1771822(-) (comFC) [Lactococcus protaetiae strain KACC 19320]
ATTTATACCACAGGAGCAACCTTACAGCACGCTACTCATCTTCTTAAAGATTCAGGTGTTAGAGAAATCAAGACTTTTTC
GTTATGTCGCTAA
ATTTATACCACAGGAGCAACCTTACAGCACGCTACTCATCTTCTTAAAGATTCAGGTGTTAGAGAAATCAAGACTTTTTC
GTTATGTCGCTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comFC | Lactococcus lactis subsp. cremoris KW2 |
56.667 |
100 |
0.567 |
| comFC/cflB | Streptococcus pneumoniae Rx1 |
50 |
100 |
0.5 |
| comFC/cflB | Streptococcus pneumoniae D39 |
50 |
100 |
0.5 |
| comFC/cflB | Streptococcus pneumoniae R6 |
50 |
100 |
0.5 |
| comFC/cflB | Streptococcus pneumoniae TIGR4 |
50 |
100 |
0.5 |
| comFC/cflB | Streptococcus mitis SK321 |
46.667 |
100 |
0.467 |
| comFC/cflB | Streptococcus mitis NCTC 12261 |
46.667 |
100 |
0.467 |
| comF | Vibrio cholerae strain A1552 |
46.429 |
93.333 |
0.433 |
| comFC | Bacillus subtilis subsp. subtilis str. 168 |
41.935 |
100 |
0.433 |
| comF | Vibrio campbellii strain DS40M4 |
42.857 |
93.333 |
0.4 |