Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | FIU13_RS02655 | Genome accession | NZ_CP040997 |
| Coordinates | 506244..506426 (-) | Length | 60 a.a. |
| NCBI ID | WP_011184907.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain FDAARGOS_774 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 506244..547457 | 506244..506426 | within | 0 |
Gene organization within MGE regions
Location: 506244..547457
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FIU13_RS02655 (FIU13_02655) | prx | 506244..506426 (-) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
| FIU13_RS02660 (FIU13_02660) | sda3 | 506664..507464 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| FIU13_RS02665 (FIU13_02665) | - | 507737..508171 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| FIU13_RS10235 | - | 508221..508631 (-) | 411 | WP_228549912.1 | hypothetical protein | - |
| FIU13_RS10240 | - | 508779..509087 (-) | 309 | WP_228549913.1 | hypothetical protein | - |
| FIU13_RS02675 (FIU13_02675) | - | 509075..509599 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| FIU13_RS02680 (FIU13_02680) | - | 509739..510944 (-) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| FIU13_RS10385 | - | 510932..511054 (-) | 123 | WP_029713948.1 | hypothetical protein | - |
| FIU13_RS02685 (FIU13_02685) | - | 511056..511511 (-) | 456 | WP_011184730.1 | phage holin family protein | - |
| FIU13_RS02690 (FIU13_02690) | - | 511521..512153 (-) | 633 | WP_011888699.1 | hypothetical protein | - |
| FIU13_RS02695 (FIU13_02695) | - | 512156..512587 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| FIU13_RS02700 (FIU13_02700) | - | 512599..514485 (-) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| FIU13_RS02705 (FIU13_02705) | - | 514498..515508 (-) | 1011 | WP_011017589.1 | hyaluronoglucosaminidase | - |
| FIU13_RS02710 (FIU13_02710) | - | 515505..517649 (-) | 2145 | WP_014635605.1 | phage tail spike protein | - |
| FIU13_RS02715 (FIU13_02715) | - | 517646..518362 (-) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| FIU13_RS02720 (FIU13_02720) | - | 518359..521619 (-) | 3261 | WP_029714384.1 | tape measure protein | - |
| FIU13_RS02725 (FIU13_02725) | - | 521609..522190 (-) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| FIU13_RS02730 (FIU13_02730) | - | 522194..522628 (-) | 435 | WP_011888695.1 | hypothetical protein | - |
| FIU13_RS02735 (FIU13_02735) | - | 522672..523133 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| FIU13_RS02740 (FIU13_02740) | - | 523133..523531 (-) | 399 | WP_011888694.1 | minor capsid protein | - |
| FIU13_RS02745 (FIU13_02745) | - | 523528..523884 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| FIU13_RS02750 (FIU13_02750) | - | 523884..524216 (-) | 333 | WP_011888693.1 | minor capsid protein | - |
| FIU13_RS02755 (FIU13_02755) | - | 524206..524622 (-) | 417 | WP_011888692.1 | hypothetical protein | - |
| FIU13_RS02760 (FIU13_02760) | - | 524676..525494 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| FIU13_RS02765 (FIU13_02765) | - | 525498..526112 (-) | 615 | WP_011888690.1 | hypothetical protein | - |
| FIU13_RS02770 (FIU13_02770) | - | 526238..526504 (-) | 267 | WP_011888689.1 | hypothetical protein | - |
| FIU13_RS02775 (FIU13_02775) | - | 526591..526818 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| FIU13_RS02780 (FIU13_02780) | - | 526818..528311 (-) | 1494 | WP_029714379.1 | phage minor capsid protein | - |
| FIU13_RS02785 (FIU13_02785) | - | 528316..529818 (-) | 1503 | WP_010922075.1 | phage portal protein | - |
| FIU13_RS02790 (FIU13_02790) | - | 529832..531123 (-) | 1292 | Protein_554 | PBSX family phage terminase large subunit | - |
| FIU13_RS02795 (FIU13_02795) | - | 531126..531602 (-) | 477 | WP_010922073.1 | hypothetical protein | - |
| FIU13_RS02800 (FIU13_02800) | - | 531945..533111 (-) | 1167 | Protein_556 | DNA modification methylase | - |
| FIU13_RS02815 (FIU13_02815) | - | 533745..534179 (-) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FIU13_RS10110 | - | 534463..534633 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| FIU13_RS02820 (FIU13_02820) | - | 534630..535109 (-) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| FIU13_RS02825 (FIU13_02825) | - | 535114..535746 (-) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| FIU13_RS02830 (FIU13_02830) | - | 535748..536032 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| FIU13_RS10115 | - | 536029..536199 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| FIU13_RS02835 (FIU13_02835) | - | 536196..536432 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| FIU13_RS10420 (FIU13_02840) | - | 536432..536677 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| FIU13_RS02845 (FIU13_02845) | - | 536674..537030 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| FIU13_RS02850 (FIU13_02850) | - | 537027..537467 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FIU13_RS02855 (FIU13_02855) | - | 537467..537670 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| FIU13_RS02860 (FIU13_02860) | ssb | 537676..538101 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| FIU13_RS02865 (FIU13_02865) | - | 538094..538768 (-) | 675 | WP_029714396.1 | ERF family protein | - |
| FIU13_RS02870 (FIU13_02870) | - | 538769..539251 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| FIU13_RS02875 (FIU13_02875) | - | 539273..539527 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| FIU13_RS02880 (FIU13_02880) | - | 539508..539861 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| FIU13_RS02885 (FIU13_02885) | - | 540002..540784 (-) | 783 | WP_011888684.1 | ATP-binding protein | - |
| FIU13_RS02890 (FIU13_02890) | - | 540771..541532 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| FIU13_RS02895 (FIU13_02895) | - | 541626..541763 (-) | 138 | WP_011017881.1 | hypothetical protein | - |
| FIU13_RS02900 (FIU13_02900) | - | 541794..542045 (-) | 252 | WP_011888682.1 | helix-turn-helix transcriptional regulator | - |
| FIU13_RS02905 (FIU13_02905) | - | 542116..542301 (-) | 186 | WP_011054585.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS02910 (FIU13_02910) | - | 542468..542707 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| FIU13_RS02915 (FIU13_02915) | - | 542805..543524 (-) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| FIU13_RS02920 (FIU13_02920) | - | 543552..543764 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| FIU13_RS02925 (FIU13_02925) | - | 543962..544303 (+) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS02930 (FIU13_02930) | - | 544287..544673 (+) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FIU13_RS02935 (FIU13_02935) | - | 544688..546109 (+) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| FIU13_RS02940 (FIU13_02940) | - | 546291..547457 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6976.99 Da Isoelectric Point: 4.2550
>NTDB_id=368589 FIU13_RS02655 WP_011184907.1 506244..506426(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
MLTYDEFKQAIDRGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEIVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=368589 FIU13_RS02655 WP_011184907.1 506244..506426(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGATAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |