Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | FIU13_RS01930 | Genome accession | NZ_CP040997 |
| Coordinates | 368952..369134 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714291.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain FDAARGOS_774 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 368952..407710 | 368952..369134 | within | 0 |
Gene organization within MGE regions
Location: 368952..407710
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FIU13_RS01930 (FIU13_01930) | prx | 368952..369134 (-) | 183 | WP_029714291.1 | hypothetical protein | Regulator |
| FIU13_RS01935 (FIU13_01935) | sda3 | 369363..370163 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| FIU13_RS01940 (FIU13_01940) | - | 370434..370868 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| FIU13_RS01945 (FIU13_01945) | - | 370938..372143 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| FIU13_RS01950 (FIU13_01950) | - | 372259..372486 (-) | 228 | WP_003058873.1 | phage holin | - |
| FIU13_RS01955 (FIU13_01955) | - | 372483..372758 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| FIU13_RS01960 (FIU13_01960) | - | 372768..373385 (-) | 618 | WP_010922447.1 | DUF1366 domain-containing protein | - |
| FIU13_RS01965 (FIU13_01965) | - | 373388..373819 (-) | 432 | WP_010922448.1 | DUF1617 family protein | - |
| FIU13_RS01970 (FIU13_01970) | - | 373831..375615 (-) | 1785 | WP_010922449.1 | gp58-like family protein | - |
| FIU13_RS01975 (FIU13_01975) | - | 375630..376631 (-) | 1002 | WP_023079488.1 | hyaluronidase HylP | - |
| FIU13_RS01980 (FIU13_01980) | - | 376631..378589 (-) | 1959 | WP_010922451.1 | phage tail spike protein | - |
| FIU13_RS01985 (FIU13_01985) | - | 378586..379281 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| FIU13_RS01990 (FIU13_01990) | - | 379278..381635 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| FIU13_RS01995 (FIU13_01995) | - | 381635..382006 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| FIU13_RS02000 (FIU13_02000) | - | 382021..382284 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| FIU13_RS02005 (FIU13_02005) | - | 382295..382888 (-) | 594 | WP_010922456.1 | tail protein | - |
| FIU13_RS02010 (FIU13_02010) | - | 382900..383235 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| FIU13_RS02015 (FIU13_02015) | - | 383236..383472 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| FIU13_RS02020 (FIU13_02020) | - | 383465..383803 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| FIU13_RS02025 (FIU13_02025) | - | 383763..384185 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| FIU13_RS02030 (FIU13_02030) | - | 384195..384395 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| FIU13_RS02035 (FIU13_02035) | - | 384395..385306 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| FIU13_RS02040 (FIU13_02040) | - | 385331..385792 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| FIU13_RS02045 (FIU13_02045) | - | 385873..387288 (-) | 1416 | WP_011285619.1 | terminase | - |
| FIU13_RS02050 (FIU13_02050) | - | 387398..387664 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| FIU13_RS02055 (FIU13_02055) | - | 387657..387836 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| FIU13_RS02060 (FIU13_02060) | - | 387886..388110 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| FIU13_RS02065 (FIU13_02065) | - | 388116..389609 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| FIU13_RS02070 (FIU13_02070) | - | 389602..390870 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| FIU13_RS02075 (FIU13_02075) | - | 390867..391223 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| FIU13_RS02080 (FIU13_02080) | - | 391372..391716 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| FIU13_RS02085 (FIU13_02085) | - | 391825..392244 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| FIU13_RS02090 (FIU13_02090) | - | 392512..393147 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| FIU13_RS02095 (FIU13_02095) | - | 393149..393418 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| FIU13_RS02100 (FIU13_02100) | - | 393502..394014 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| FIU13_RS02105 (FIU13_02105) | - | 394011..394352 (-) | 342 | WP_020837403.1 | hypothetical protein | - |
| FIU13_RS10100 | - | 394530..394697 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| FIU13_RS02110 (FIU13_02110) | - | 394707..395504 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| FIU13_RS02115 (FIU13_02115) | - | 395501..396430 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| FIU13_RS02120 (FIU13_02120) | - | 396433..396762 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| FIU13_RS02125 (FIU13_02125) | - | 396818..397024 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| FIU13_RS02130 (FIU13_02130) | - | 397033..397173 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| FIU13_RS02135 (FIU13_02135) | - | 397170..397403 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| FIU13_RS02140 (FIU13_02140) | - | 397384..397770 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| FIU13_RS10230 (FIU13_02145) | - | 397911..398180 (-) | 270 | WP_011106700.1 | replication protein | - |
| FIU13_RS02150 (FIU13_02150) | - | 398274..398459 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| FIU13_RS02155 (FIU13_02155) | - | 398461..398772 (-) | 312 | WP_010922478.1 | excisionase | - |
| FIU13_RS02160 (FIU13_02160) | - | 399042..399254 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS02165 (FIU13_02165) | - | 399455..400210 (+) | 756 | WP_010922480.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS02170 (FIU13_02170) | - | 400222..400740 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| FIU13_RS02175 (FIU13_02175) | - | 400864..402006 (+) | 1143 | WP_003051793.1 | tyrosine-type recombinase/integrase | - |
| FIU13_RS02180 (FIU13_02180) | - | 402095..402370 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| FIU13_RS02185 (FIU13_02185) | - | 402469..403056 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| FIU13_RS02190 (FIU13_02190) | - | 403034..403876 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| FIU13_RS02195 (FIU13_02195) | - | 403869..404708 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| FIU13_RS02200 (FIU13_02200) | - | 404936..405877 (-) | 942 | WP_011285633.1 | LPXTG cell wall anchor domain-containing protein | - |
| FIU13_RS02205 (FIU13_02205) | recN | 406049..407710 (-) | 1662 | WP_010922485.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6974.02 Da Isoelectric Point: 4.7361
>NTDB_id=368586 FIU13_RS01930 WP_029714291.1 368952..369134(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDRGYITGDTVMIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=368586 FIU13_RS01930 WP_029714291.1 368952..369134(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAACAAGCGATTGACCGTGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
95 |
100 |
0.95 |
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |