Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | FIU13_RS01085 | Genome accession | NZ_CP040997 |
| Coordinates | 206256..206444 (-) | Length | 62 a.a. |
| NCBI ID | WP_011285559.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain FDAARGOS_774 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 196332..245937 | 206256..206444 | within | 0 |
Gene organization within MGE regions
Location: 196332..245937
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FIU13_RS01040 (FIU13_01040) | lepB | 196332..196889 (-) | 558 | WP_002984449.1 | signal peptidase I | - |
| FIU13_RS01045 (FIU13_01045) | pyk | 197107..198609 (-) | 1503 | WP_002984447.1 | pyruvate kinase | - |
| FIU13_RS01050 (FIU13_01050) | pfkA | 198672..199685 (-) | 1014 | WP_010922375.1 | 6-phosphofructokinase | - |
| FIU13_RS01055 (FIU13_01055) | - | 199765..202875 (-) | 3111 | WP_010922376.1 | DNA polymerase III subunit alpha | - |
| FIU13_RS01060 (FIU13_01060) | - | 203060..203431 (+) | 372 | WP_010922377.1 | GntR family transcriptional regulator | - |
| FIU13_RS01065 (FIU13_01065) | - | 203431..204129 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| FIU13_RS01070 (FIU13_01070) | - | 204139..204924 (+) | 786 | WP_010922378.1 | hypothetical protein | - |
| FIU13_RS01075 (FIU13_01075) | - | 205051..205665 (-) | 615 | WP_011285558.1 | TVP38/TMEM64 family protein | - |
| FIU13_RS01085 (FIU13_01085) | prx | 206256..206444 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| FIU13_RS01090 (FIU13_01090) | speA | 206665..207420 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| FIU13_RS01095 (FIU13_01095) | - | 207542..208201 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| FIU13_RS01100 (FIU13_01100) | - | 208201..208422 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| FIU13_RS01105 (FIU13_01105) | - | 208432..209205 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| FIU13_RS01110 (FIU13_01110) | - | 209216..209818 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| FIU13_RS01115 (FIU13_01115) | - | 209830..210594 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| FIU13_RS01120 (FIU13_01120) | - | 210596..210928 (-) | 333 | WP_011285562.1 | phage holin | - |
| FIU13_RS01125 (FIU13_01125) | - | 210928..211251 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| FIU13_RS10365 | - | 211265..211387 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| FIU13_RS01130 (FIU13_01130) | - | 211401..211748 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| FIU13_RS01135 (FIU13_01135) | - | 211759..213621 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| FIU13_RS01140 (FIU13_01140) | - | 213626..217066 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| FIU13_RS01145 (FIU13_01145) | - | 217067..218551 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| FIU13_RS01150 (FIU13_01150) | - | 218552..220357 (-) | 1806 | WP_011054802.1 | tail protein | - |
| FIU13_RS01155 (FIU13_01155) | - | 220350..220808 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| FIU13_RS01160 (FIU13_01160) | - | 220781..221098 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| FIU13_RS01165 (FIU13_01165) | - | 221111..221617 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| FIU13_RS01170 (FIU13_01170) | - | 221629..222039 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| FIU13_RS01175 (FIU13_01175) | - | 222041..222436 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| FIU13_RS01180 (FIU13_01180) | - | 222433..222744 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| FIU13_RS01185 (FIU13_01185) | - | 222741..223079 (-) | 339 | WP_029714010.1 | hypothetical protein | - |
| FIU13_RS01190 (FIU13_01190) | - | 223093..223386 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| FIU13_RS01195 (FIU13_01195) | - | 223399..224289 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| FIU13_RS01200 (FIU13_01200) | - | 224308..224877 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| FIU13_RS10370 | - | 224986..225120 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| FIU13_RS01205 (FIU13_01205) | - | 225122..225391 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| FIU13_RS01210 (FIU13_01210) | - | 225398..226306 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| FIU13_RS01215 (FIU13_01215) | - | 226275..227600 (-) | 1326 | WP_029714009.1 | phage portal protein | - |
| FIU13_RS01220 (FIU13_01220) | - | 227600..228874 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| FIU13_RS01225 (FIU13_01225) | - | 228864..229244 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| FIU13_RS01230 (FIU13_01230) | - | 229854..230288 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FIU13_RS01235 (FIU13_01235) | - | 230574..230840 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| FIU13_RS01240 (FIU13_01240) | - | 230837..231361 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| FIU13_RS01245 (FIU13_01245) | - | 231364..231996 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| FIU13_RS01250 (FIU13_01250) | - | 231998..232282 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| FIU13_RS10090 | - | 232279..232449 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| FIU13_RS01255 (FIU13_01255) | - | 232446..232682 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| FIU13_RS10410 (FIU13_01260) | - | 232682..232927 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| FIU13_RS01265 (FIU13_01265) | - | 232924..233280 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| FIU13_RS01270 (FIU13_01270) | - | 233277..233717 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FIU13_RS01275 (FIU13_01275) | - | 233717..233920 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| FIU13_RS01280 (FIU13_01280) | ssb | 233926..234351 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| FIU13_RS01285 (FIU13_01285) | - | 234344..235018 (-) | 675 | WP_046735269.1 | ERF family protein | - |
| FIU13_RS01290 (FIU13_01290) | - | 235019..235501 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| FIU13_RS01295 (FIU13_01295) | - | 235523..235777 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| FIU13_RS01300 (FIU13_01300) | - | 235758..236111 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| FIU13_RS01305 (FIU13_01305) | - | 236252..237034 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| FIU13_RS01310 (FIU13_01310) | - | 237021..237851 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FIU13_RS01315 (FIU13_01315) | - | 237865..238179 (-) | 315 | WP_023610888.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS10375 | - | 238195..238329 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| FIU13_RS01320 (FIU13_01320) | - | 238326..238622 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| FIU13_RS01325 (FIU13_01325) | - | 238659..238922 (-) | 264 | WP_029714276.1 | hypothetical protein | - |
| FIU13_RS01330 (FIU13_01330) | - | 238977..239486 (+) | 510 | WP_011017884.1 | hypothetical protein | - |
| FIU13_RS01335 (FIU13_01335) | - | 239617..239826 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| FIU13_RS01340 (FIU13_01340) | - | 239936..240136 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| FIU13_RS01345 (FIU13_01345) | - | 240210..240596 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| FIU13_RS01350 (FIU13_01350) | - | 240585..240794 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| FIU13_RS01355 (FIU13_01355) | - | 240848..241447 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| FIU13_RS01360 (FIU13_01360) | - | 241477..241635 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| FIU13_RS01365 (FIU13_01365) | - | 241992..242816 (+) | 825 | WP_011285584.1 | XRE family transcriptional regulator | - |
| FIU13_RS01370 (FIU13_01370) | - | 242852..243745 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| FIU13_RS01375 (FIU13_01375) | - | 243866..244954 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| FIU13_RS01380 (FIU13_01380) | - | 245317..245937 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7290.41 Da Isoelectric Point: 4.3313
>NTDB_id=368582 FIU13_RS01085 WP_011285559.1 206256..206444(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=368582 FIU13_RS01085 WP_011285559.1 206256..206444(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
95.161 |
0.952 |
| prx | Streptococcus pyogenes MGAS315 |
79.032 |
100 |
0.79 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
95.161 |
0.661 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |