Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   FIU13_RS01085 Genome accession   NZ_CP040997
Coordinates   206256..206444 (-) Length   62 a.a.
NCBI ID   WP_011285559.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain FDAARGOS_774     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 196332..245937 206256..206444 within 0


Gene organization within MGE regions


Location: 196332..245937
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FIU13_RS01040 (FIU13_01040) lepB 196332..196889 (-) 558 WP_002984449.1 signal peptidase I -
  FIU13_RS01045 (FIU13_01045) pyk 197107..198609 (-) 1503 WP_002984447.1 pyruvate kinase -
  FIU13_RS01050 (FIU13_01050) pfkA 198672..199685 (-) 1014 WP_010922375.1 6-phosphofructokinase -
  FIU13_RS01055 (FIU13_01055) - 199765..202875 (-) 3111 WP_010922376.1 DNA polymerase III subunit alpha -
  FIU13_RS01060 (FIU13_01060) - 203060..203431 (+) 372 WP_010922377.1 GntR family transcriptional regulator -
  FIU13_RS01065 (FIU13_01065) - 203431..204129 (+) 699 WP_002984437.1 ABC transporter ATP-binding protein -
  FIU13_RS01070 (FIU13_01070) - 204139..204924 (+) 786 WP_010922378.1 hypothetical protein -
  FIU13_RS01075 (FIU13_01075) - 205051..205665 (-) 615 WP_011285558.1 TVP38/TMEM64 family protein -
  FIU13_RS01085 (FIU13_01085) prx 206256..206444 (-) 189 WP_011285559.1 hypothetical protein Regulator
  FIU13_RS01090 (FIU13_01090) speA 206665..207420 (+) 756 WP_009880239.1 streptococcal pyrogenic exotoxin SpeA -
  FIU13_RS01095 (FIU13_01095) - 207542..208201 (-) 660 WP_009880240.1 hypothetical protein -
  FIU13_RS01100 (FIU13_01100) - 208201..208422 (-) 222 WP_009880241.1 hypothetical protein -
  FIU13_RS01105 (FIU13_01105) - 208432..209205 (-) 774 WP_011054795.1 hypothetical protein -
  FIU13_RS01110 (FIU13_01110) - 209216..209818 (-) 603 WP_011054796.1 hypothetical protein -
  FIU13_RS01115 (FIU13_01115) - 209830..210594 (-) 765 WP_011285561.1 CHAP domain-containing protein -
  FIU13_RS01120 (FIU13_01120) - 210596..210928 (-) 333 WP_011285562.1 phage holin -
  FIU13_RS01125 (FIU13_01125) - 210928..211251 (-) 324 WP_015055952.1 hypothetical protein -
  FIU13_RS10365 - 211265..211387 (-) 123 WP_015055953.1 hypothetical protein -
  FIU13_RS01130 (FIU13_01130) - 211401..211748 (-) 348 WP_011285564.1 DUF1366 domain-containing protein -
  FIU13_RS01135 (FIU13_01135) - 211759..213621 (-) 1863 WP_015055954.1 DUF859 family phage minor structural protein -
  FIU13_RS01140 (FIU13_01140) - 213626..217066 (-) 3441 WP_011285566.1 glucosaminidase domain-containing protein -
  FIU13_RS01145 (FIU13_01145) - 217067..218551 (-) 1485 WP_009880250.1 distal tail protein Dit -
  FIU13_RS01150 (FIU13_01150) - 218552..220357 (-) 1806 WP_011054802.1 tail protein -
  FIU13_RS01155 (FIU13_01155) - 220350..220808 (-) 459 WP_009880253.1 hypothetical protein -
  FIU13_RS01160 (FIU13_01160) - 220781..221098 (-) 318 WP_009880254.1 hypothetical protein -
  FIU13_RS01165 (FIU13_01165) - 221111..221617 (-) 507 WP_009880255.1 phage major tail protein, TP901-1 family -
  FIU13_RS01170 (FIU13_01170) - 221629..222039 (-) 411 WP_009880256.1 DUF5072 family protein -
  FIU13_RS01175 (FIU13_01175) - 222041..222436 (-) 396 WP_009880257.1 hypothetical protein -
  FIU13_RS01180 (FIU13_01180) - 222433..222744 (-) 312 WP_011285567.1 hypothetical protein -
  FIU13_RS01185 (FIU13_01185) - 222741..223079 (-) 339 WP_029714010.1 hypothetical protein -
  FIU13_RS01190 (FIU13_01190) - 223093..223386 (-) 294 WP_009880260.1 HeH/LEM domain-containing protein -
  FIU13_RS01195 (FIU13_01195) - 223399..224289 (-) 891 WP_009880261.1 hypothetical protein -
  FIU13_RS01200 (FIU13_01200) - 224308..224877 (-) 570 WP_009880262.1 DUF4355 domain-containing protein -
  FIU13_RS10370 - 224986..225120 (-) 135 WP_015055956.1 hypothetical protein -
  FIU13_RS01205 (FIU13_01205) - 225122..225391 (-) 270 WP_011285568.1 hypothetical protein -
  FIU13_RS01210 (FIU13_01210) - 225398..226306 (-) 909 WP_011285569.1 minor capsid protein -
  FIU13_RS01215 (FIU13_01215) - 226275..227600 (-) 1326 WP_029714009.1 phage portal protein -
  FIU13_RS01220 (FIU13_01220) - 227600..228874 (-) 1275 WP_009880266.1 PBSX family phage terminase large subunit -
  FIU13_RS01225 (FIU13_01225) - 228864..229244 (-) 381 WP_011285571.1 hypothetical protein -
  FIU13_RS01230 (FIU13_01230) - 229854..230288 (-) 435 WP_011054810.1 ArpU family phage packaging/lysis transcriptional regulator -
  FIU13_RS01235 (FIU13_01235) - 230574..230840 (-) 267 WP_011018131.1 hypothetical protein -
  FIU13_RS01240 (FIU13_01240) - 230837..231361 (-) 525 WP_011285572.1 DUF1642 domain-containing protein -
  FIU13_RS01245 (FIU13_01245) - 231364..231996 (-) 633 WP_011018133.1 N-6 DNA methylase -
  FIU13_RS01250 (FIU13_01250) - 231998..232282 (-) 285 WP_011018134.1 hypothetical protein -
  FIU13_RS10090 - 232279..232449 (-) 171 WP_002995952.1 hypothetical protein -
  FIU13_RS01255 (FIU13_01255) - 232446..232682 (-) 237 WP_002995955.1 DUF3310 domain-containing protein -
  FIU13_RS10410 (FIU13_01260) - 232682..232927 (-) 246 WP_011285573.1 hypothetical protein -
  FIU13_RS01265 (FIU13_01265) - 232924..233280 (-) 357 WP_011284873.1 hypothetical protein -
  FIU13_RS01270 (FIU13_01270) - 233277..233717 (-) 441 WP_011285574.1 RusA family crossover junction endodeoxyribonuclease -
  FIU13_RS01275 (FIU13_01275) - 233717..233920 (-) 204 WP_011106686.1 hypothetical protein -
  FIU13_RS01280 (FIU13_01280) ssb 233926..234351 (-) 426 WP_011285575.1 single-stranded DNA-binding protein Machinery gene
  FIU13_RS01285 (FIU13_01285) - 234344..235018 (-) 675 WP_046735269.1 ERF family protein -
  FIU13_RS01290 (FIU13_01290) - 235019..235501 (-) 483 WP_011018142.1 siphovirus Gp157 family protein -
  FIU13_RS01295 (FIU13_01295) - 235523..235777 (-) 255 WP_011018143.1 hypothetical protein -
  FIU13_RS01300 (FIU13_01300) - 235758..236111 (-) 354 WP_011285579.1 hypothetical protein -
  FIU13_RS01305 (FIU13_01305) - 236252..237034 (-) 783 WP_011285581.1 ATP-binding protein -
  FIU13_RS01310 (FIU13_01310) - 237021..237851 (-) 831 WP_009881060.1 phage replisome organizer N-terminal domain-containing protein -
  FIU13_RS01315 (FIU13_01315) - 237865..238179 (-) 315 WP_023610888.1 helix-turn-helix domain-containing protein -
  FIU13_RS10375 - 238195..238329 (-) 135 WP_002995985.1 hypothetical protein -
  FIU13_RS01320 (FIU13_01320) - 238326..238622 (-) 297 WP_011054584.1 MerR family transcriptional regulator -
  FIU13_RS01325 (FIU13_01325) - 238659..238922 (-) 264 WP_029714276.1 hypothetical protein -
  FIU13_RS01330 (FIU13_01330) - 238977..239486 (+) 510 WP_011017884.1 hypothetical protein -
  FIU13_RS01335 (FIU13_01335) - 239617..239826 (+) 210 WP_011017885.1 hypothetical protein -
  FIU13_RS01340 (FIU13_01340) - 239936..240136 (-) 201 WP_002992770.1 helix-turn-helix domain-containing protein -
  FIU13_RS01345 (FIU13_01345) - 240210..240596 (+) 387 WP_011054589.1 hypothetical protein -
  FIU13_RS01350 (FIU13_01350) - 240585..240794 (-) 210 WP_011284881.1 hypothetical protein -
  FIU13_RS01355 (FIU13_01355) - 240848..241447 (+) 600 WP_011284882.1 hypothetical protein -
  FIU13_RS01360 (FIU13_01360) - 241477..241635 (-) 159 WP_011285583.1 hypothetical protein -
  FIU13_RS01365 (FIU13_01365) - 241992..242816 (+) 825 WP_011285584.1 XRE family transcriptional regulator -
  FIU13_RS01370 (FIU13_01370) - 242852..243745 (+) 894 WP_011285585.1 P63C domain-containing protein -
  FIU13_RS01375 (FIU13_01375) - 243866..244954 (+) 1089 WP_011054595.1 site-specific integrase -
  FIU13_RS01380 (FIU13_01380) - 245317..245937 (+) 621 WP_002989605.1 DUF3862 domain-containing protein -

Sequence


Protein


Download         Length: 62 a.a.        Molecular weight: 7290.41 Da        Isoelectric Point: 4.3313

>NTDB_id=368582 FIU13_RS01085 WP_011285559.1 206256..206444(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDYIK

Nucleotide


Download         Length: 189 bp        

>NTDB_id=368582 FIU13_RS01085 WP_011285559.1 206256..206444(-) (prx) [Streptococcus pyogenes strain FDAARGOS_774]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

100

95.161

0.952

  prx Streptococcus pyogenes MGAS315

79.032

100

0.79

  prx Streptococcus pyogenes MGAS8232

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS315

76.271

95.161

0.726

  prx Streptococcus pyogenes MGAS315

74.576

95.161

0.71

  prx Streptococcus pyogenes MGAS315

69.492

95.161

0.661

  prx Streptococcus pyogenes MGAS315

82.927

66.129

0.548


Multiple sequence alignment