NTDB

Overview

Name	clpP	Type	Regulator
Locus tag	GSF71_RS08105	Genome accession	NZ_CP048116
Coordinates	1633222..1633806 (-)	Length	194 a.a.
NCBI ID	WP_025016311.1	Uniprot ID	-
Organism	Latilactobacillus sakei strain MBEL1397
Function	degradation of ComX (predicted from homology) Competence regulation

Genomic Context

Location: 1628222..1638806

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GSF71_RS08075	-	1628287..1628823 (+)	537	WP_016264747.1	DUF308 domain-containing protein	-
GSF71_RS08080	rapZ	1628949..1629833 (+)	885	WP_011374234.1	RNase adapter RapZ	-
GSF71_RS08085	-	1629830..1630864 (+)	1035	WP_016264749.1	gluconeogenesis factor YvcK family protein	-
GSF71_RS08090	whiA	1630867..1631811 (+)	945	WP_011374236.1	DNA-binding protein WhiA	-
GSF71_RS08095	-	1631903..1632358 (+)	456	WP_035146456.1	MarR family winged helix-turn-helix transcriptional regulator	-
GSF71_RS08100	-	1632473..1632997 (-)	525	WP_162100939.1	DsbA family protein	-
GSF71_RS08105	clpP	1633222..1633806 (-)	585	WP_025016311.1	ATP-dependent Clp endopeptidase proteolytic subunit ClpP	Regulator
GSF71_RS08110	-	1634326..1634661 (-)	336	WP_162101014.1	glycoside hydrolase family 73 protein	-
GSF71_RS08115	-	1634643..1634906 (-)	264	WP_162100940.1	glucosaminidase domain-containing protein	-
GSF71_RS08120	-	1635121..1636080 (+)	960	WP_025016309.1	nucleoside hydrolase	-
GSF71_RS08125	-	1636270..1638219 (+)	1950	WP_061827219.1	adhesive domain-containing protein	-

Sequence

Protein

Download Length: 194 a.a. Molecular weight: 21244.27 Da Isoelectric Point: 4.6805

                                >NTDB_id=367285 GSF71_RS08105 WP_025016311.1 1633222..1633806(-) (clpP) [Latilactobacillus sakei strain MBEL1397]

MLVPTVIEQTSRGERAYDIYSRLLKDRIIMLSGEVNDQMANTIIAQLLFLDAQDSDKDISIYINSPGGSVTAGLAIMDTM

NFIKSDVQTIAMGMAASMASVLLSAGTKGKRFALPNSTVLIHQPLGGAQGQQTEIEIAAREILKTRKRLNQILADNSGQS

FEKLQADTDRDNYMTAQEAKDYGLIDDIMVNQPK

Nucleotide

Download Length: 585 bp

                                >NTDB_id=367285 GSF71_RS08105 WP_025016311.1 1633222..1633806(-) (clpP) [Latilactobacillus sakei strain MBEL1397]

ATGTTAGTACCGACAGTTATCGAACAAACATCTCGTGGCGAACGCGCCTACGATATTTACTCTCGTTTACTAAAAGACCG

GATCATCATGTTATCTGGTGAAGTAAACGACCAAATGGCTAACACAATCATTGCGCAATTACTATTCTTGGATGCGCAAG

ATTCAGATAAGGATATTTCAATCTACATCAACTCACCTGGTGGTTCTGTGACAGCCGGTTTGGCAATCATGGATACAATG

AACTTCATTAAATCTGATGTTCAAACAATCGCTATGGGCATGGCTGCTTCAATGGCCAGCGTTTTACTTTCAGCTGGGAC

AAAAGGCAAACGTTTTGCATTGCCTAACTCAACAGTCTTGATTCACCAACCTTTAGGTGGTGCACAAGGTCAACAAACTG

AAATTGAAATCGCAGCTCGCGAAATTTTGAAGACTCGGAAACGTTTGAACCAAATCTTGGCAGATAATTCTGGTCAAAGC

TTCGAAAAATTACAAGCAGACACTGATCGTGATAACTACATGACAGCCCAAGAAGCAAAAGATTACGGTTTGATTGACGA

CATTATGGTTAACCAACCAAAATAG

Domains

Predicted by InterProScan.

Clp protease (CLP_protease)

(12-191)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
clpP	Lactococcus lactis subsp. cremoris KW2	71.354	98.969	0.706
clpP	Lactococcus lactis subsp. lactis strain DGCC12653	69.271	98.969	0.686
clpP	Streptococcus pneumoniae D39	68.229	98.969	0.675
clpP	Streptococcus pneumoniae R6	68.229	98.969	0.675
clpP	Streptococcus pneumoniae TIGR4	68.229	98.969	0.675
clpP	Streptococcus thermophilus LMD-9	68.229	98.969	0.675
clpP	Streptococcus thermophilus LMG 18311	68.229	98.969	0.675
clpP	Streptococcus pneumoniae Rx1	68.229	98.969	0.675
clpP	Bacillus subtilis subsp. subtilis str. 168	66.842	97.938	0.655
clpP	Streptococcus mutans UA159	65.625	98.969	0.649
clpP	Streptococcus pyogenes JRS4	64.583	98.969	0.639
clpP	Streptococcus pyogenes MGAS315	64.583	98.969	0.639
clpP	Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819	64.021	97.423	0.624

Detailed information NTG0367285