Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | FDP16_RS03245 | Genome accession | NZ_CP040798 |
| Coordinates | 637646..638263 (+) | Length | 205 a.a. |
| NCBI ID | WP_256254472.1 | Uniprot ID | - |
| Organism | Streptococcus sanguinis strain CGMH058 | ||
| Function | degradation of ComX; degradation of ComW (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 619121..650273 | 637646..638263 | within | 0 |
Gene organization within MGE regions
Location: 619121..650273
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FDP16_RS03130 (FDP16_03240) | - | 619121..620056 (+) | 936 | WP_176798538.1 | manganese-dependent inorganic pyrophosphatase | - |
| FDP16_RS03135 (FDP16_03245) | - | 620149..620661 (+) | 513 | WP_176798539.1 | YiiX/YebB-like N1pC/P60 family cysteine hydrolase | - |
| FDP16_RS03140 (FDP16_03250) | - | 620654..620812 (+) | 159 | Protein_586 | DUF1803 domain-containing protein | - |
| FDP16_RS03145 (FDP16_03255) | - | 620967..621290 (+) | 324 | WP_176798540.1 | DUF2568 domain-containing protein | - |
| FDP16_RS03150 (FDP16_03260) | - | 621335..621988 (+) | 654 | WP_176798541.1 | DUF1803 domain-containing protein | - |
| FDP16_RS03155 (FDP16_03265) | - | 622090..622284 (+) | 195 | WP_176798542.1 | CsbD family protein | - |
| FDP16_RS03160 (FDP16_03270) | - | 622522..623277 (+) | 756 | WP_218134319.1 | CPBP family intramembrane glutamic endopeptidase | - |
| FDP16_RS03165 (FDP16_03275) | - | 623457..624902 (-) | 1446 | WP_176798544.1 | UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--L- lysine ligase | - |
| FDP16_RS03170 (FDP16_03280) | - | 624989..626617 (+) | 1629 | WP_176798545.1 | polysaccharide biosynthesis protein | - |
| FDP16_RS03175 (FDP16_03285) | - | 627031..627447 (-) | 417 | WP_176798546.1 | DUF1492 domain-containing protein | - |
| FDP16_RS03180 (FDP16_03290) | - | 627561..627782 (+) | 222 | WP_176798547.1 | hypothetical protein | - |
| FDP16_RS11760 (FDP16_03295) | - | 627889..628395 (-) | 507 | WP_256254471.1 | hypothetical protein | - |
| FDP16_RS03185 (FDP16_03300) | - | 628492..629019 (-) | 528 | WP_176798548.1 | hypothetical protein | - |
| FDP16_RS03190 (FDP16_03305) | - | 629042..629764 (-) | 723 | WP_176798549.1 | ATP-binding protein | - |
| FDP16_RS03195 (FDP16_03310) | - | 629775..630626 (-) | 852 | WP_176798550.1 | DnaD domain protein | - |
| FDP16_RS03200 (FDP16_03315) | - | 630619..630894 (-) | 276 | WP_176798551.1 | MerR family transcriptional regulator | - |
| FDP16_RS03205 (FDP16_03320) | - | 630902..631240 (-) | 339 | WP_176798552.1 | hypothetical protein | - |
| FDP16_RS11765 | - | 631264..631398 (-) | 135 | WP_256254400.1 | hypothetical protein | - |
| FDP16_RS03210 (FDP16_03325) | - | 631853..632089 (-) | 237 | WP_176798553.1 | hypothetical protein | - |
| FDP16_RS03215 (FDP16_03330) | - | 632104..632289 (-) | 186 | WP_176798554.1 | hypothetical protein | - |
| FDP16_RS03220 (FDP16_03335) | - | 632444..632944 (+) | 501 | WP_176798555.1 | helix-turn-helix transcriptional regulator | - |
| FDP16_RS03225 (FDP16_03340) | - | 633034..634290 (+) | 1257 | WP_176798556.1 | site-specific integrase | - |
| FDP16_RS03230 (FDP16_03345) | - | 634448..635605 (+) | 1158 | WP_176798557.1 | cystathionine gamma-synthase | - |
| FDP16_RS03235 (FDP16_03350) | - | 635607..636773 (+) | 1167 | WP_176798558.1 | MalY/PatB family protein | - |
| FDP16_RS03240 (FDP16_03360) | upp | 636936..637565 (+) | 630 | WP_002903228.1 | uracil phosphoribosyltransferase | - |
| FDP16_RS03245 (FDP16_03365) | clpP | 637646..638263 (+) | 618 | WP_256254472.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
| FDP16_RS03250 (FDP16_03370) | - | 638416..638685 (+) | 270 | WP_176798560.1 | YlbG family protein | - |
| FDP16_RS03255 (FDP16_03375) | - | 638774..639934 (+) | 1161 | WP_176798561.1 | ABC transporter substrate-binding protein | - |
| FDP16_RS03260 (FDP16_03380) | - | 640184..641053 (+) | 870 | WP_176798562.1 | branched-chain amino acid ABC transporter permease | - |
| FDP16_RS03265 (FDP16_03385) | - | 641057..642010 (+) | 954 | WP_125331161.1 | branched-chain amino acid ABC transporter permease | - |
| FDP16_RS03270 (FDP16_03390) | - | 642010..642774 (+) | 765 | WP_176798563.1 | ABC transporter ATP-binding protein | - |
| FDP16_RS03275 (FDP16_03395) | - | 642774..643484 (+) | 711 | WP_002894681.1 | ABC transporter ATP-binding protein | - |
| FDP16_RS03280 (FDP16_03400) | - | 644294..644950 (+) | 657 | WP_176798564.1 | CBS domain-containing protein | - |
| FDP16_RS03285 (FDP16_03405) | - | 644986..645873 (-) | 888 | WP_176798565.1 | YitT family protein | - |
| FDP16_RS03290 (FDP16_03415) | tmk | 646187..646825 (+) | 639 | WP_176798566.1 | dTMP kinase | - |
| FDP16_RS03295 (FDP16_03420) | - | 646822..647712 (+) | 891 | WP_176798567.1 | DNA polymerase III subunit delta' | - |
| FDP16_RS03300 (FDP16_03425) | yabA | 647737..648054 (+) | 318 | WP_002894690.1 | DNA replication initiation control protein YabA | - |
| FDP16_RS03305 (FDP16_03430) | rsmI | 648057..648923 (+) | 867 | WP_176798568.1 | 16S rRNA (cytidine(1402)-2'-O)-methyltransferase | - |
| FDP16_RS03310 (FDP16_03435) | serC | 649182..650273 (+) | 1092 | WP_176798569.1 | 3-phosphoserine/phosphohydroxythreonine transaminase | - |
Sequence
Protein
Download Length: 205 a.a. Molecular weight: 22712.94 Da Isoelectric Point: 4.7792
>NTDB_id=367213 FDP16_RS03245 WP_256254472.1 637646..638263(+) (clpP) [Streptococcus sanguinis strain CGMH058]
MLKREREKTMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNTKDIYLYVNTPGGSVSA
GLAIVDTMNFIKSDVQTIVMGVAASMGTVIASSGAKGKRFMLPNAEYLIHQPMGGAGSGTQQTDMAIVAEHLLRTRNTLE
KILAENSGKSVEQIHKDAERDYWMSAQETLEYGFIDEIMENSNLS
MLKREREKTMIPVVIEQTSRGERSYDIYSRLLKDRIIMLTGPVEDNMANSIIAQLLFLDAQDNTKDIYLYVNTPGGSVSA
GLAIVDTMNFIKSDVQTIVMGVAASMGTVIASSGAKGKRFMLPNAEYLIHQPMGGAGSGTQQTDMAIVAEHLLRTRNTLE
KILAENSGKSVEQIHKDAERDYWMSAQETLEYGFIDEIMENSNLS
Nucleotide
Download Length: 618 bp
>NTDB_id=367213 FDP16_RS03245 WP_256254472.1 637646..638263(+) (clpP) [Streptococcus sanguinis strain CGMH058]
ATTTTAAAAAGAGAAAGAGAGAAAACTATGATTCCTGTAGTTATTGAACAAACCAGCCGAGGGGAGCGCTCCTATGACAT
TTATTCTCGGCTATTAAAAGATCGGATTATCATGCTGACTGGTCCAGTAGAGGATAATATGGCTAATTCAATCATTGCCC
AGCTCCTTTTCTTGGATGCACAGGACAATACTAAAGATATTTATCTCTATGTAAATACGCCGGGTGGTTCTGTTTCAGCA
GGTCTGGCTATTGTGGACACTATGAACTTCATCAAGTCTGATGTTCAGACCATTGTTATGGGTGTAGCTGCCAGCATGGG
AACGGTCATTGCTTCCAGTGGTGCCAAAGGCAAACGCTTCATGCTTCCAAATGCAGAATATCTGATTCACCAGCCGATGG
GCGGAGCTGGAAGCGGCACTCAGCAAACGGATATGGCAATTGTAGCTGAGCACTTGCTTAGAACTCGGAATACCTTGGAA
AAAATCTTGGCAGAAAACTCTGGTAAGTCTGTTGAGCAAATCCACAAGGATGCAGAGCGTGATTACTGGATGAGTGCTCA
AGAAACTTTGGAATACGGCTTTATTGACGAAATCATGGAAAATAGCAATTTAAGCTAA
ATTTTAAAAAGAGAAAGAGAGAAAACTATGATTCCTGTAGTTATTGAACAAACCAGCCGAGGGGAGCGCTCCTATGACAT
TTATTCTCGGCTATTAAAAGATCGGATTATCATGCTGACTGGTCCAGTAGAGGATAATATGGCTAATTCAATCATTGCCC
AGCTCCTTTTCTTGGATGCACAGGACAATACTAAAGATATTTATCTCTATGTAAATACGCCGGGTGGTTCTGTTTCAGCA
GGTCTGGCTATTGTGGACACTATGAACTTCATCAAGTCTGATGTTCAGACCATTGTTATGGGTGTAGCTGCCAGCATGGG
AACGGTCATTGCTTCCAGTGGTGCCAAAGGCAAACGCTTCATGCTTCCAAATGCAGAATATCTGATTCACCAGCCGATGG
GCGGAGCTGGAAGCGGCACTCAGCAAACGGATATGGCAATTGTAGCTGAGCACTTGCTTAGAACTCGGAATACCTTGGAA
AAAATCTTGGCAGAAAACTCTGGTAAGTCTGTTGAGCAAATCCACAAGGATGCAGAGCGTGATTACTGGATGAGTGCTCA
AGAAACTTTGGAATACGGCTTTATTGACGAAATCATGGAAAATAGCAATTTAAGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Streptococcus pneumoniae R6 |
90.306 |
95.61 |
0.863 |
| clpP | Streptococcus pneumoniae Rx1 |
90.306 |
95.61 |
0.863 |
| clpP | Streptococcus pneumoniae D39 |
90.306 |
95.61 |
0.863 |
| clpP | Streptococcus pneumoniae TIGR4 |
90.306 |
95.61 |
0.863 |
| clpP | Streptococcus pyogenes JRS4 |
89.744 |
95.122 |
0.854 |
| clpP | Streptococcus pyogenes MGAS315 |
89.744 |
95.122 |
0.854 |
| clpP | Streptococcus mutans UA159 |
87.5 |
97.561 |
0.854 |
| clpP | Streptococcus thermophilus LMG 18311 |
88.718 |
95.122 |
0.844 |
| clpP | Streptococcus thermophilus LMD-9 |
88.718 |
95.122 |
0.844 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
87.692 |
95.122 |
0.834 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
87.179 |
95.122 |
0.829 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
60.104 |
94.146 |
0.566 |
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
56.995 |
94.146 |
0.537 |