Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | E3C75_RS02290 | Genome accession | NZ_CP038020 |
| Coordinates | 423958..424146 (+) | Length | 62 a.a. |
| NCBI ID | WP_111679075.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain ATCC 19258 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 416521..425216 | 423958..424146 | within | 0 |
Gene organization within MGE regions
Location: 416521..425216
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3C75_RS02230 | - | 416521..417687 (-) | 1167 | WP_111679066.1 | site-specific integrase | - |
| E3C75_RS11435 | - | 417829..418410 (-) | 582 | WP_084828737.1 | helix-turn-helix transcriptional regulator | - |
| E3C75_RS02240 | - | 418560..418730 (+) | 171 | WP_084829211.1 | transcriptional regulator | - |
| E3C75_RS02245 | - | 418983..419276 (+) | 294 | WP_111679067.1 | hypothetical protein | - |
| E3C75_RS02250 | - | 419280..419474 (+) | 195 | WP_024704077.1 | hypothetical protein | - |
| E3C75_RS02255 | - | 419488..419724 (+) | 237 | WP_024704076.1 | hypothetical protein | - |
| E3C75_RS11440 | - | 419711..419923 (+) | 213 | WP_240899459.1 | hypothetical protein | - |
| E3C75_RS02265 | - | 420060..420332 (+) | 273 | WP_023909303.1 | MerR family transcriptional regulator | - |
| E3C75_RS02270 | - | 420347..421207 (+) | 861 | WP_111679069.1 | primase alpha helix C-terminal domain-containing protein | - |
| E3C75_RS02275 | - | 421197..422702 (+) | 1506 | WP_111679071.1 | DNA primase family protein | - |
| E3C75_RS02280 | - | 422999..423184 (+) | 186 | WP_111679073.1 | hypothetical protein | - |
| E3C75_RS02285 | - | 423250..423477 (+) | 228 | WP_223899748.1 | hypothetical protein | - |
| E3C75_RS02290 | prx | 423958..424146 (+) | 189 | WP_111679075.1 | hypothetical protein | Regulator |
| E3C75_RS02295 | - | 424527..425216 (+) | 690 | WP_197709066.1 | DUF3800 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7133.08 Da Isoelectric Point: 4.5837
>NTDB_id=351387 E3C75_RS02290 WP_111679075.1 423958..424146(+) (prx) [Streptococcus thermophilus strain ATCC 19258]
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
MLTYDEFKEAMDNGFIKGDTVQIVRKNGKIHDYVLDGERVEPHEILRLEKVSDIIKELGGDN
Nucleotide
Download Length: 189 bp
>NTDB_id=351387 E3C75_RS02290 WP_111679075.1 423958..424146(+) (prx) [Streptococcus thermophilus strain ATCC 19258]
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
ATGCTAACCTATGATGAATTTAAAGAGGCAATGGACAATGGTTTTATTAAAGGTGATACTGTCCAGATTGTCCGAAAGAA
TGGTAAGATCCATGACTACGTTTTAGACGGTGAACGAGTTGAGCCACACGAAATATTGAGATTAGAAAAAGTATCGGATA
TAATAAAAGAACTAGGCGGAGACAACTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
60.345 |
93.548 |
0.565 |
| prx | Streptococcus pyogenes MGAS8232 |
59.322 |
95.161 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
57.627 |
95.161 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
56.897 |
93.548 |
0.532 |
| prx | Streptococcus pyogenes MGAS315 |
74.419 |
69.355 |
0.516 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
65.957 |
75.806 |
0.5 |