Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | SDEG_RS07850 | Genome accession | NC_012891 |
| Coordinates | 1568857..1569039 (-) | Length | 60 a.a. |
| NCBI ID | WP_012767356.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae subsp. equisimilis GGS_124 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1565920..1613655 | 1568857..1569039 | within | 0 |
Gene organization within MGE regions
Location: 1565920..1613655
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SDEG_RS07840 (SDEG_1602) | - | 1565920..1566828 (-) | 909 | WP_231844016.1 | ABC transporter ATP-binding protein | - |
| SDEG_RS07845 (SDEG_1604) | rlmD | 1567309..1568667 (-) | 1359 | WP_012767355.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| SDEG_RS07850 (SDEG_1605) | prx | 1568857..1569039 (-) | 183 | WP_012767356.1 | hypothetical protein | Regulator |
| SDEG_RS07855 (SDEG_1606) | acrIIA3 | 1569210..1569584 (+) | 375 | WP_012767357.1 | anti-CRISPR protein AcrIIA3 | - |
| SDEG_RS07860 (SDEG_1607) | - | 1569584..1570186 (+) | 603 | WP_012767358.1 | AP2 domain-containing protein | - |
| SDEG_RS07865 (SDEG_1608) | - | 1570188..1570403 (+) | 216 | WP_023611751.1 | hypothetical protein | - |
| SDEG_RS07870 | - | 1570472..1570711 (+) | 240 | WP_003055855.1 | hypothetical protein | - |
| SDEG_RS07875 (SDEG_1609) | - | 1570914..1572263 (-) | 1350 | WP_012767360.1 | peptidoglycan amidohydrolase family protein | - |
| SDEG_RS07880 (SDEG_1610) | - | 1572265..1572597 (-) | 333 | WP_012767361.1 | phage holin | - |
| SDEG_RS07885 (SDEG_1611) | - | 1572597..1572920 (-) | 324 | WP_012767362.1 | hypothetical protein | - |
| SDEG_RS11140 (SDEG_1612) | - | 1572933..1573097 (-) | 165 | WP_012767363.1 | hypothetical protein | - |
| SDEG_RS07895 (SDEG_1613) | - | 1573069..1573419 (-) | 351 | WP_012767364.1 | DUF1366 domain-containing protein | - |
| SDEG_RS07900 (SDEG_1614) | - | 1573435..1575312 (-) | 1878 | WP_012767365.1 | DUF859 family phage minor structural protein | - |
| SDEG_RS07905 (SDEG_1615) | - | 1575323..1578691 (-) | 3369 | WP_012767366.1 | glucosaminidase domain-containing protein | - |
| SDEG_RS11210 (SDEG_1616) | - | 1578692..1580176 (-) | 1485 | WP_012767367.1 | distal tail protein Dit | - |
| SDEG_RS07915 (SDEG_1617) | - | 1580177..1581121 (-) | 945 | WP_231844017.1 | hypothetical protein | - |
| SDEG_RS07920 (SDEG_1618) | - | 1581580..1582140 (-) | 561 | WP_012767369.1 | HNH endonuclease | - |
| SDEG_RS07925 (SDEG_1619) | - | 1582311..1582910 (-) | 600 | Protein_1530 | phage tail protein | - |
| SDEG_RS07930 (SDEG_1620) | - | 1582903..1583361 (-) | 459 | WP_012767371.1 | hypothetical protein | - |
| SDEG_RS07935 (SDEG_1621) | - | 1583334..1583651 (-) | 318 | WP_012767372.1 | hypothetical protein | - |
| SDEG_RS07940 (SDEG_1622) | - | 1583663..1584169 (-) | 507 | WP_012767373.1 | phage major tail protein, TP901-1 family | - |
| SDEG_RS07945 (SDEG_1623) | - | 1584181..1584591 (-) | 411 | WP_012767374.1 | DUF5072 family protein | - |
| SDEG_RS07950 (SDEG_1624) | - | 1584593..1584988 (-) | 396 | WP_012767375.1 | hypothetical protein | - |
| SDEG_RS07955 (SDEG_1625) | - | 1584985..1585296 (-) | 312 | WP_012767376.1 | hypothetical protein | - |
| SDEG_RS07960 (SDEG_1626) | - | 1585293..1585637 (-) | 345 | WP_012767377.1 | hypothetical protein | - |
| SDEG_RS07965 (SDEG_1627) | - | 1585651..1585944 (-) | 294 | WP_012767378.1 | HeH/LEM domain-containing protein | - |
| SDEG_RS07970 (SDEG_1628) | - | 1585956..1586846 (-) | 891 | WP_012767379.1 | hypothetical protein | - |
| SDEG_RS07975 (SDEG_1629) | - | 1586864..1587433 (-) | 570 | WP_041789106.1 | DUF4355 domain-containing protein | - |
| SDEG_RS11455 | - | 1587540..1587674 (-) | 135 | WP_269146490.1 | hypothetical protein | - |
| SDEG_RS07980 (SDEG_1630) | - | 1587676..1587903 (-) | 228 | WP_012767381.1 | hypothetical protein | - |
| SDEG_RS07985 (SDEG_1631) | - | 1587910..1588818 (-) | 909 | WP_012767382.1 | minor capsid protein | - |
| SDEG_RS07990 (SDEG_1632) | - | 1588787..1590112 (-) | 1326 | WP_012767383.1 | phage portal protein | - |
| SDEG_RS07995 (SDEG_1633) | - | 1590112..1591386 (-) | 1275 | WP_012767384.1 | PBSX family phage terminase large subunit | - |
| SDEG_RS08000 (SDEG_1634) | - | 1591376..1591756 (-) | 381 | WP_012767385.1 | hypothetical protein | - |
| SDEG_RS08005 (SDEG_1636) | - | 1592285..1592725 (-) | 441 | WP_012767387.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SDEG_RS08010 (SDEG_1638) | - | 1593083..1593616 (-) | 534 | WP_012767389.1 | DUF1642 domain-containing protein | - |
| SDEG_RS08015 (SDEG_1639) | - | 1593606..1593854 (-) | 249 | WP_012767390.1 | hypothetical protein | - |
| SDEG_RS08020 (SDEG_1640) | - | 1593858..1594127 (-) | 270 | WP_012767391.1 | hypothetical protein | - |
| SDEG_RS08025 (SDEG_1641) | - | 1594124..1594528 (-) | 405 | WP_012767392.1 | YopX family protein | - |
| SDEG_RS08030 (SDEG_1642) | - | 1594525..1594737 (-) | 213 | WP_012767393.1 | hypothetical protein | - |
| SDEG_RS11255 (SDEG_1643) | - | 1594787..1595122 (-) | 336 | WP_012767394.1 | hypothetical protein | - |
| SDEG_RS08040 (SDEG_1644) | - | 1595115..1595402 (-) | 288 | WP_012767395.1 | nucleotide modification associated domain-containing protein | - |
| SDEG_RS08045 (SDEG_1645) | - | 1595399..1595647 (-) | 249 | WP_012767396.1 | hypothetical protein | - |
| SDEG_RS08050 (SDEG_1646) | - | 1595644..1596000 (-) | 357 | WP_012767397.1 | hypothetical protein | - |
| SDEG_RS08055 (SDEG_1647) | - | 1595997..1596437 (-) | 441 | WP_012767398.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SDEG_RS11390 (SDEG_1648) | - | 1596437..1596640 (-) | 204 | WP_012767399.1 | hypothetical protein | - |
| SDEG_RS08065 (SDEG_1649) | ssbA | 1596646..1597065 (-) | 420 | WP_012767400.1 | single-stranded DNA-binding protein | Machinery gene |
| SDEG_RS08070 (SDEG_1650) | - | 1597058..1597732 (-) | 675 | WP_012767401.1 | ERF family protein | - |
| SDEG_RS08075 (SDEG_1651) | - | 1597733..1598215 (-) | 483 | WP_012767402.1 | siphovirus Gp157 family protein | - |
| SDEG_RS08080 (SDEG_1652) | - | 1598236..1598490 (-) | 255 | WP_012767403.1 | hypothetical protein | - |
| SDEG_RS08085 (SDEG_1653) | - | 1598477..1598827 (-) | 351 | WP_012767404.1 | hypothetical protein | - |
| SDEG_RS08090 (SDEG_1655) | - | 1598965..1599747 (-) | 783 | WP_012767406.1 | ATP-binding protein | - |
| SDEG_RS08095 (SDEG_1656) | - | 1599734..1600549 (-) | 816 | WP_012767407.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SDEG_RS08100 (SDEG_1657) | - | 1600550..1600756 (-) | 207 | WP_012767408.1 | hypothetical protein | - |
| SDEG_RS11215 (SDEG_1658) | - | 1600737..1600877 (-) | 141 | WP_012767409.1 | hypothetical protein | - |
| SDEG_RS08105 (SDEG_1659) | - | 1600908..1601159 (-) | 252 | WP_012767410.1 | helix-turn-helix transcriptional regulator | - |
| SDEG_RS08110 (SDEG_1660) | - | 1601289..1601501 (-) | 213 | WP_012767411.1 | helix-turn-helix transcriptional regulator | - |
| SDEG_RS08115 (SDEG_1661) | - | 1601698..1602039 (+) | 342 | WP_012767412.1 | helix-turn-helix domain-containing protein | - |
| SDEG_RS08120 (SDEG_1662) | - | 1602023..1602400 (+) | 378 | WP_012767413.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SDEG_RS08125 (SDEG_1663) | - | 1602409..1603095 (+) | 687 | WP_012767414.1 | hypothetical protein | - |
| SDEG_RS08130 (SDEG_1665) | - | 1603268..1604434 (+) | 1167 | WP_041789110.1 | tyrosine-type recombinase/integrase | - |
| SDEG_RS08135 (SDEG_1666) | recX | 1604582..1605358 (+) | 777 | WP_012767417.1 | recombination regulator RecX | - |
| SDEG_RS08140 (SDEG_1667) | - | 1605440..1605973 (+) | 534 | WP_003061431.1 | nucleoside tri-diphosphate phosphatase | - |
| SDEG_RS08145 (SDEG_1668) | - | 1606027..1606338 (+) | 312 | WP_003053435.1 | DUF960 domain-containing protein | - |
| SDEG_RS08205 (SDEG_1680) | - | 1612630..1613649 (-) | 1020 | Protein_1577 | IS30 family transposase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7030.88 Da Isoelectric Point: 4.1677
>NTDB_id=34399 SDEG_RS07850 WP_012767356.1 1568857..1569039(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
MLTYDEFKQAIDDGYITGAAVTIVRKNGQIFDYVLPHEEVRSWEVSIEERVEDVLRELDK
MLTYDEFKQAIDDGYITGAAVTIVRKNGQIFDYVLPHEEVRSWEVSIEERVEDVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=34399 SDEG_RS07850 WP_012767356.1 1568857..1569039(-) (prx) [Streptococcus dysgalactiae subsp. equisimilis GGS_124]
ATGCTAACATACGATGAATTTAAGCAGGCGATTGATGACGGGTATATCACAGGAGCCGCAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAAGAGTAGAAGACG
TGTTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAATTTAAGCAGGCGATTGATGACGGGTATATCACAGGAGCCGCAGTCACGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTATTGCCGCATGAGGAAGTGAGGTCGTGGGAGGTGTCAATAGAAGAAAGAGTAGAAGACG
TGTTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS8232 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
100 |
0.667 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
75.61 |
68.333 |
0.517 |