Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT44_RS04570 | Genome accession | NZ_CP035455 |
| Coordinates | 849171..849359 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain emm197 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 807392..851480 | 849171..849359 | within | 0 |
Gene organization within MGE regions
Location: 807392..851480
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT44_RS04290 (ETT44_04290) | - | 807392..808012 (-) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
| ETT44_RS04295 (ETT44_04295) | - | 808375..809463 (-) | 1089 | WP_023079773.1 | site-specific integrase | - |
| ETT44_RS04300 (ETT44_04300) | - | 809583..809888 (-) | 306 | WP_011106738.1 | membrane protein | - |
| ETT44_RS04305 (ETT44_04305) | - | 809898..810686 (-) | 789 | WP_021340822.1 | S24 family peptidase | - |
| ETT44_RS04310 (ETT44_04310) | - | 811059..811217 (+) | 159 | WP_136022037.1 | hypothetical protein | - |
| ETT44_RS04315 (ETT44_04315) | - | 811351..812136 (-) | 786 | WP_136022036.1 | hypothetical protein | - |
| ETT44_RS09290 | - | 812193..812339 (+) | 147 | WP_021340823.1 | hypothetical protein | - |
| ETT44_RS04320 (ETT44_04320) | - | 812336..812818 (-) | 483 | WP_023605145.1 | hypothetical protein | - |
| ETT44_RS04325 (ETT44_04325) | - | 812892..813131 (+) | 240 | WP_021340169.1 | helix-turn-helix transcriptional regulator | - |
| ETT44_RS04335 (ETT44_04335) | - | 813347..813556 (-) | 210 | WP_002984292.1 | hypothetical protein | - |
| ETT44_RS04340 (ETT44_04340) | - | 813732..813950 (-) | 219 | WP_023079659.1 | hypothetical protein | - |
| ETT44_RS04345 (ETT44_04345) | - | 814093..814269 (+) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| ETT44_RS04350 (ETT44_04350) | - | 814347..814643 (+) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| ETT44_RS04355 (ETT44_04355) | - | 814640..814777 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| ETT44_RS04360 (ETT44_04360) | - | 814858..815187 (+) | 330 | WP_002984312.1 | hypothetical protein | - |
| ETT44_RS04365 (ETT44_04365) | - | 815187..815381 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| ETT44_RS04370 (ETT44_04370) | - | 815378..815662 (+) | 285 | WP_002984318.1 | hypothetical protein | - |
| ETT44_RS04375 (ETT44_04375) | - | 815659..816342 (+) | 684 | WP_136019689.1 | AAA family ATPase | - |
| ETT44_RS04380 (ETT44_04380) | - | 816348..817781 (+) | 1434 | Protein_782 | DEAD/DEAH box helicase | - |
| ETT44_RS04385 (ETT44_04385) | - | 817786..818268 (+) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| ETT44_RS04390 (ETT44_04390) | - | 818286..819839 (+) | 1554 | WP_011017876.1 | hypothetical protein | - |
| ETT44_RS04395 (ETT44_04395) | - | 820108..820977 (+) | 870 | WP_085577343.1 | bifunctional DNA primase/polymerase | - |
| ETT44_RS04400 (ETT44_04400) | - | 820997..821281 (+) | 285 | WP_011284874.1 | VRR-NUC domain-containing protein | - |
| ETT44_RS04405 (ETT44_04405) | - | 821265..821621 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| ETT44_RS09610 (ETT44_04410) | - | 821618..821867 (+) | 250 | Protein_788 | hypothetical protein | - |
| ETT44_RS04415 (ETT44_04415) | - | 821861..822145 (+) | 285 | WP_136019687.1 | DUF3310 domain-containing protein | - |
| ETT44_RS04420 (ETT44_04420) | - | 822142..822555 (+) | 414 | WP_085577344.1 | YopX family protein | - |
| ETT44_RS09295 | - | 822552..822758 (+) | 207 | WP_085577345.1 | hypothetical protein | - |
| ETT44_RS04425 (ETT44_04425) | - | 822782..823222 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT44_RS04430 (ETT44_04430) | - | 823612..823950 (+) | 339 | WP_063632710.1 | HNH endonuclease | - |
| ETT44_RS04435 (ETT44_04435) | - | 824121..824588 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ETT44_RS04440 (ETT44_04440) | - | 824591..824821 (+) | 231 | WP_085577347.1 | hypothetical protein | - |
| ETT44_RS04445 (ETT44_04445) | - | 824825..826579 (+) | 1755 | WP_063632717.1 | terminase large subunit | - |
| ETT44_RS09300 | - | 826576..826746 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| ETT44_RS04450 (ETT44_04450) | - | 826739..826963 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| ETT44_RS04455 (ETT44_04455) | - | 826997..828217 (+) | 1221 | WP_011017578.1 | phage portal protein | - |
| ETT44_RS04460 (ETT44_04460) | - | 828195..828860 (+) | 666 | WP_032465106.1 | head maturation protease, ClpP-related | - |
| ETT44_RS04465 (ETT44_04465) | - | 828885..830072 (+) | 1188 | WP_011017580.1 | phage major capsid protein | - |
| ETT44_RS09555 | - | 830086..830214 (+) | 129 | WP_001118388.1 | hypothetical protein | - |
| ETT44_RS04470 (ETT44_04470) | - | 830217..830519 (+) | 303 | WP_063812171.1 | head-tail connector protein | - |
| ETT44_RS04475 (ETT44_04475) | - | 830516..830854 (+) | 339 | WP_136022035.1 | phage head closure protein | - |
| ETT44_RS04480 (ETT44_04480) | - | 830851..831228 (+) | 378 | WP_085577348.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT44_RS04485 (ETT44_04485) | - | 831225..831650 (+) | 426 | WP_011017584.1 | hypothetical protein | - |
| ETT44_RS04490 (ETT44_04490) | - | 831666..832274 (+) | 609 | WP_011017585.1 | major tail protein | - |
| ETT44_RS04495 (ETT44_04495) | - | 832327..832653 (+) | 327 | WP_011017586.1 | hypothetical protein | - |
| ETT44_RS09305 | - | 832701..832850 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| ETT44_RS04500 (ETT44_04500) | - | 832863..836786 (+) | 3924 | WP_136022034.1 | phage tail tape measure protein | - |
| ETT44_RS04505 (ETT44_04505) | - | 836786..837493 (+) | 708 | WP_136278035.1 | distal tail protein Dit | - |
| ETT44_RS04510 (ETT44_04510) | - | 837490..839634 (+) | 2145 | WP_136278034.1 | phage tail spike protein | - |
| ETT44_RS04515 (ETT44_04515) | - | 839631..840656 (+) | 1026 | WP_136022061.1 | hyaluronoglucosaminidase | - |
| ETT44_RS04520 (ETT44_04520) | - | 840666..842570 (+) | 1905 | WP_136022060.1 | gp58-like family protein | - |
| ETT44_RS04525 (ETT44_04525) | - | 842582..843010 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ETT44_RS04530 (ETT44_04530) | - | 843013..843645 (+) | 633 | WP_129796151.1 | hypothetical protein | - |
| ETT44_RS04535 (ETT44_04535) | - | 843655..843951 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| ETT44_RS04540 (ETT44_04540) | - | 843948..844133 (+) | 186 | WP_002990010.1 | holin | - |
| ETT44_RS04545 (ETT44_04545) | - | 844244..845452 (+) | 1209 | WP_136022059.1 | glucosaminidase domain-containing protein | - |
| ETT44_RS04550 (ETT44_04550) | - | 845592..846116 (+) | 525 | WP_136296969.1 | Panacea domain-containing protein | - |
| ETT44_RS04555 (ETT44_04555) | - | 846104..846970 (+) | 867 | WP_014635498.1 | DUF334 domain-containing protein | - |
| ETT44_RS04560 (ETT44_04560) | spem | 847273..847986 (+) | 714 | WP_014635497.1 | streptococcal pyrogenic exotoxin SpeM | - |
| ETT44_RS04565 (ETT44_04565) | spel | 848268..849056 (+) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| ETT44_RS04570 (ETT44_04570) | prx | 849171..849359 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| ETT44_RS04580 (ETT44_04580) | - | 849950..850564 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ETT44_RS04585 (ETT44_04585) | - | 850695..851480 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=342520 ETT44_RS04570 WP_011054546.1 849171..849359(+) (prx) [Streptococcus pyogenes strain emm197]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=342520 ETT44_RS04570 WP_011054546.1 849171..849359(+) (prx) [Streptococcus pyogenes strain emm197]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |