Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT44_RS03740 | Genome accession | NZ_CP035455 |
| Coordinates | 688708..688890 (+) | Length | 60 a.a. |
| NCBI ID | WP_011184726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm197 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 653461..688890 | 688708..688890 | within | 0 |
Gene organization within MGE regions
Location: 653461..688890
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT44_RS03470 (ETT44_03470) | - | 653461..653736 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT44_RS03475 (ETT44_03475) | - | 653825..654967 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT44_RS03480 (ETT44_03480) | - | 655091..655609 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ETT44_RS03485 (ETT44_03485) | - | 655621..656376 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ETT44_RS03490 (ETT44_03490) | - | 656578..656790 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ETT44_RS03495 (ETT44_03495) | - | 657060..657371 (+) | 312 | WP_010922478.1 | excisionase | - |
| ETT44_RS03500 (ETT44_03500) | - | 657373..657558 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| ETT44_RS09410 (ETT44_03505) | - | 657652..657921 (+) | 270 | WP_011106700.1 | replication protein | - |
| ETT44_RS03510 (ETT44_03510) | - | 658062..658448 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ETT44_RS03515 (ETT44_03515) | - | 658429..658662 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| ETT44_RS03520 (ETT44_03520) | - | 658659..658799 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| ETT44_RS03525 (ETT44_03525) | - | 658808..659014 (+) | 207 | WP_002988357.1 | hypothetical protein | - |
| ETT44_RS03530 (ETT44_03530) | - | 659070..659399 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| ETT44_RS03535 (ETT44_03535) | - | 659402..660376 (+) | 975 | WP_136021976.1 | recombinase RecT | - |
| ETT44_RS03540 (ETT44_03540) | - | 660373..661170 (+) | 798 | WP_136021975.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ETT44_RS03545 (ETT44_03545) | - | 661348..661689 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT44_RS03550 (ETT44_03550) | - | 661686..662198 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| ETT44_RS03555 (ETT44_03555) | - | 662185..662388 (+) | 204 | WP_063629031.1 | hypothetical protein | - |
| ETT44_RS03560 (ETT44_03560) | - | 662375..662659 (+) | 285 | WP_136021974.1 | hypothetical protein | - |
| ETT44_RS03565 (ETT44_03565) | - | 662663..663145 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| ETT44_RS03570 (ETT44_03570) | - | 663135..663899 (+) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| ETT44_RS03575 (ETT44_03575) | - | 663947..664240 (+) | 294 | WP_136021973.1 | hypothetical protein | - |
| ETT44_RS03580 (ETT44_03580) | - | 664237..664740 (+) | 504 | WP_136021972.1 | DUF1642 domain-containing protein | - |
| ETT44_RS09280 | - | 664737..664907 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| ETT44_RS03585 (ETT44_03585) | - | 665174..665593 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ETT44_RS03590 (ETT44_03590) | - | 665700..666044 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| ETT44_RS03595 (ETT44_03595) | - | 666193..666549 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT44_RS03600 (ETT44_03600) | - | 666546..667814 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| ETT44_RS03605 (ETT44_03605) | - | 667807..669300 (+) | 1494 | WP_136021971.1 | hypothetical protein | - |
| ETT44_RS03610 (ETT44_03610) | - | 669306..669530 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT44_RS09285 | - | 669607..669759 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| ETT44_RS03615 (ETT44_03615) | - | 669752..670018 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT44_RS03620 (ETT44_03620) | - | 670020..670256 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| ETT44_RS03625 (ETT44_03625) | - | 670338..671753 (+) | 1416 | WP_136021970.1 | terminase | - |
| ETT44_RS03630 (ETT44_03630) | - | 671834..672295 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ETT44_RS03635 (ETT44_03635) | - | 672320..673231 (+) | 912 | WP_129322662.1 | phage major capsid protein | - |
| ETT44_RS03640 (ETT44_03640) | - | 673231..673431 (+) | 201 | WP_136021969.1 | hypothetical protein | - |
| ETT44_RS03645 (ETT44_03645) | - | 673441..673860 (+) | 420 | WP_063662149.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT44_RS03650 (ETT44_03650) | - | 673823..674161 (+) | 339 | WP_136021968.1 | hypothetical protein | - |
| ETT44_RS03655 (ETT44_03655) | - | 674154..674390 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| ETT44_RS03660 (ETT44_03660) | - | 674391..674726 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| ETT44_RS03665 (ETT44_03665) | - | 674742..675332 (+) | 591 | WP_063629038.1 | hypothetical protein | - |
| ETT44_RS03670 (ETT44_03670) | - | 675343..675606 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT44_RS03675 (ETT44_03675) | - | 675621..675992 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ETT44_RS03680 (ETT44_03680) | - | 675992..678355 (+) | 2364 | WP_136021967.1 | hypothetical protein | - |
| ETT44_RS03685 (ETT44_03685) | - | 678352..679047 (+) | 696 | WP_002992579.1 | hypothetical protein | - |
| ETT44_RS03690 (ETT44_03690) | - | 679029..681005 (+) | 1977 | WP_168392908.1 | phage tail spike protein | - |
| ETT44_RS03695 (ETT44_03695) | hylP | 681002..682111 (+) | 1110 | WP_136021965.1 | hyaluronoglucosaminidase | - |
| ETT44_RS03700 (ETT44_03700) | - | 682126..683907 (+) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| ETT44_RS03705 (ETT44_03705) | - | 683916..684344 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| ETT44_RS03710 (ETT44_03710) | - | 684347..684979 (+) | 633 | WP_011528779.1 | hypothetical protein | - |
| ETT44_RS03715 (ETT44_03715) | - | 684991..685263 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT44_RS03720 (ETT44_03720) | - | 685260..685487 (+) | 228 | WP_003058873.1 | phage holin | - |
| ETT44_RS03725 (ETT44_03725) | - | 685606..686823 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| ETT44_RS03730 (ETT44_03730) | speC | 686892..687599 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ETT44_RS03735 (ETT44_03735) | mf2 | 687710..688468 (-) | 759 | WP_011184727.1 | DNase Mf2 | - |
| ETT44_RS03740 (ETT44_03740) | prx | 688708..688890 (+) | 183 | WP_011184726.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6936.91 Da Isoelectric Point: 4.1954
>NTDB_id=342517 ETT44_RS03740 WP_011184726.1 688708..688890(+) (prx) [Streptococcus pyogenes strain emm197]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=342517 ETT44_RS03740 WP_011184726.1 688708..688890(+) (prx) [Streptococcus pyogenes strain emm197]
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAACAAGCAATTGACAATGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS8232 |
86.667 |
100 |
0.867 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |