Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT45_RS04935 | Genome accession | NZ_CP035454 |
| Coordinates | 966430..966618 (-) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain emm54 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 958842..1010735 | 966430..966618 | within | 0 |
Gene organization within MGE regions
Location: 958842..1010735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT45_RS04900 (ETT45_04895) | pfkA | 958842..959855 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ETT45_RS04905 (ETT45_04900) | - | 959935..963045 (-) | 3111 | WP_002984441.1 | DNA polymerase III subunit alpha | - |
| ETT45_RS04910 (ETT45_04905) | - | 963230..963601 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ETT45_RS04915 (ETT45_04910) | - | 963601..964299 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ETT45_RS04920 (ETT45_04915) | - | 964309..965094 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ETT45_RS04925 (ETT45_04920) | - | 965225..965839 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ETT45_RS04935 (ETT45_04930) | prx | 966430..966618 (-) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| ETT45_RS04940 (ETT45_04935) | spel | 966733..967521 (-) | 789 | WP_020833516.1 | streptococcal pyrogenic exotoxin SpeL | - |
| ETT45_RS04945 (ETT45_04940) | spem | 967803..968516 (-) | 714 | WP_038431384.1 | streptococcal pyrogenic exotoxin SpeM | - |
| ETT45_RS04950 (ETT45_04945) | - | 968819..969685 (-) | 867 | WP_014635498.1 | DUF334 domain-containing protein | - |
| ETT45_RS04955 (ETT45_04950) | - | 969673..970197 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ETT45_RS04960 (ETT45_04955) | - | 970337..971545 (-) | 1209 | WP_038431388.1 | glucosaminidase domain-containing protein | - |
| ETT45_RS04965 (ETT45_04960) | - | 971661..971888 (-) | 228 | WP_000609113.1 | phage holin | - |
| ETT45_RS04970 (ETT45_04965) | - | 971885..972160 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ETT45_RS04975 (ETT45_04970) | - | 972170..972536 (-) | 367 | Protein_911 | DUF1366 domain-containing protein | - |
| ETT45_RS04980 (ETT45_04975) | - | 972539..972970 (-) | 432 | WP_053308473.1 | DUF1617 family protein | - |
| ETT45_RS04985 (ETT45_04980) | - | 972982..974886 (-) | 1905 | WP_136129595.1 | gp58-like family protein | - |
| ETT45_RS04990 (ETT45_04985) | hylP | 974901..976013 (-) | 1113 | WP_136098298.1 | hyaluronoglucosaminidase | - |
| ETT45_RS04995 (ETT45_04990) | - | 976010..978154 (-) | 2145 | WP_136129596.1 | phage tail spike protein | - |
| ETT45_RS05000 (ETT45_04995) | - | 978151..978858 (-) | 708 | WP_136129597.1 | distal tail protein Dit | - |
| ETT45_RS05005 (ETT45_05000) | - | 978858..982781 (-) | 3924 | WP_111685764.1 | phage tail tape measure protein | - |
| ETT45_RS08820 | - | 982794..982961 (-) | 168 | WP_014411856.1 | hypothetical protein | - |
| ETT45_RS05010 (ETT45_05005) | gpG | 982991..983317 (-) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| ETT45_RS05015 (ETT45_05010) | - | 983370..983978 (-) | 609 | WP_014411858.1 | major tail protein | - |
| ETT45_RS05020 (ETT45_05015) | - | 983995..984420 (-) | 426 | WP_002985347.1 | hypothetical protein | - |
| ETT45_RS05025 (ETT45_05020) | - | 984417..984794 (-) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT45_RS05030 (ETT45_05025) | - | 984791..985138 (-) | 348 | WP_063632712.1 | phage head closure protein | - |
| ETT45_RS05035 (ETT45_05030) | - | 985135..985437 (-) | 303 | WP_063631325.1 | head-tail connector protein | - |
| ETT45_RS08825 | - | 985440..985586 (-) | 147 | WP_023610896.1 | hypothetical protein | - |
| ETT45_RS05040 (ETT45_05035) | - | 985573..986775 (-) | 1203 | WP_023610889.1 | phage major capsid protein | - |
| ETT45_RS05045 (ETT45_05040) | - | 986801..987466 (-) | 666 | WP_136129600.1 | head maturation protease, ClpP-related | - |
| ETT45_RS05050 (ETT45_05045) | - | 987444..988664 (-) | 1221 | WP_063631323.1 | phage portal protein | - |
| ETT45_RS05055 (ETT45_05050) | - | 988698..988922 (-) | 225 | WP_002985363.1 | hypothetical protein | - |
| ETT45_RS08830 | - | 988915..989085 (-) | 171 | WP_002985365.1 | hypothetical protein | - |
| ETT45_RS05060 (ETT45_05055) | - | 989082..990836 (-) | 1755 | WP_136129630.1 | terminase large subunit | - |
| ETT45_RS05065 (ETT45_05060) | - | 990840..991070 (-) | 231 | WP_085577347.1 | hypothetical protein | - |
| ETT45_RS05070 (ETT45_05065) | - | 991073..991540 (-) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ETT45_RS05075 (ETT45_05070) | - | 991708..992049 (-) | 342 | WP_136129601.1 | HNH endonuclease | - |
| ETT45_RS05085 (ETT45_05080) | - | 992647..993081 (-) | 435 | WP_032461637.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT45_RS05090 (ETT45_05085) | - | 993532..994035 (-) | 504 | WP_032461638.1 | DUF1642 domain-containing protein | - |
| ETT45_RS05095 (ETT45_05090) | - | 994032..994325 (-) | 294 | WP_032461639.1 | hypothetical protein | - |
| ETT45_RS05100 (ETT45_05095) | - | 994322..994507 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| ETT45_RS09170 | - | 994616..994720 (-) | 105 | Protein_939 | SAM-dependent methyltransferase | - |
| ETT45_RS05110 (ETT45_05105) | - | 994723..995058 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| ETT45_RS05115 (ETT45_05110) | - | 995061..995345 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| ETT45_RS05120 (ETT45_05115) | - | 995342..995722 (-) | 381 | WP_020833536.1 | YopX family protein | - |
| ETT45_RS05125 (ETT45_05120) | - | 995732..996001 (-) | 270 | WP_020833537.1 | hypothetical protein | - |
| ETT45_RS05130 (ETT45_05125) | - | 995998..996273 (-) | 276 | WP_020833538.1 | nucleotide modification associated domain-containing protein | - |
| ETT45_RS09075 (ETT45_05130) | - | 996270..996501 (-) | 232 | Protein_945 | hypothetical protein | - |
| ETT45_RS05140 (ETT45_05135) | - | 996498..996854 (-) | 357 | WP_032462868.1 | hypothetical protein | - |
| ETT45_RS05145 (ETT45_05140) | - | 996838..997122 (-) | 285 | WP_011017874.1 | VRR-NUC domain-containing protein | - |
| ETT45_RS05150 (ETT45_05145) | - | 997142..998011 (-) | 870 | WP_020833541.1 | bifunctional DNA primase/polymerase | - |
| ETT45_RS05155 (ETT45_05150) | - | 998278..999831 (-) | 1554 | WP_002984332.1 | hypothetical protein | - |
| ETT45_RS05160 (ETT45_05155) | - | 999849..1000331 (-) | 483 | WP_002984328.1 | DUF669 domain-containing protein | - |
| ETT45_RS05165 (ETT45_05160) | - | 1000336..1001760 (-) | 1425 | Protein_951 | DEAD/DEAH box helicase | - |
| ETT45_RS05170 (ETT45_05165) | - | 1001775..1002458 (-) | 684 | WP_002984321.1 | AAA family ATPase | - |
| ETT45_RS05175 (ETT45_05170) | - | 1002455..1002739 (-) | 285 | WP_002984318.1 | hypothetical protein | - |
| ETT45_RS05180 (ETT45_05175) | - | 1002736..1002930 (-) | 195 | WP_002984315.1 | hypothetical protein | - |
| ETT45_RS05185 (ETT45_05180) | - | 1002930..1003259 (-) | 330 | WP_002984312.1 | hypothetical protein | - |
| ETT45_RS05190 (ETT45_05185) | - | 1003340..1003477 (-) | 138 | WP_002984309.1 | hypothetical protein | - |
| ETT45_RS05195 (ETT45_05190) | - | 1003474..1003770 (-) | 297 | WP_011017882.1 | MerR family transcriptional regulator | - |
| ETT45_RS05200 (ETT45_05195) | - | 1003848..1004024 (-) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| ETT45_RS05205 (ETT45_05200) | - | 1004168..1004392 (+) | 225 | WP_048327839.1 | hypothetical protein | - |
| ETT45_RS05210 (ETT45_05205) | - | 1004521..1005243 (-) | 723 | WP_046176843.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT45_RS05215 (ETT45_05210) | - | 1005276..1005464 (-) | 189 | WP_046176844.1 | helix-turn-helix transcriptional regulator | - |
| ETT45_RS05220 (ETT45_05215) | - | 1005520..1006359 (+) | 840 | WP_136118406.1 | DUF4393 domain-containing protein | - |
| ETT45_RS05225 (ETT45_05220) | - | 1006538..1006696 (-) | 159 | WP_014635529.1 | hypothetical protein | - |
| ETT45_RS05230 (ETT45_05225) | - | 1006755..1006970 (+) | 216 | WP_014635530.1 | hypothetical protein | - |
| ETT45_RS08835 | - | 1006956..1007105 (-) | 150 | WP_014635531.1 | hypothetical protein | - |
| ETT45_RS05235 (ETT45_05230) | - | 1007464..1008228 (+) | 765 | WP_136118408.1 | helix-turn-helix transcriptional regulator | - |
| ETT45_RS05240 (ETT45_05235) | - | 1008238..1008543 (+) | 306 | WP_046166079.1 | membrane protein | - |
| ETT45_RS05245 (ETT45_05240) | - | 1008664..1009752 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| ETT45_RS05250 (ETT45_05245) | - | 1010115..1010735 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=342468 ETT45_RS04935 WP_011054546.1 966430..966618(-) (prx) [Streptococcus pyogenes strain emm54]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=342468 ETT45_RS04935 WP_011054546.1 966430..966618(-) (prx) [Streptococcus pyogenes strain emm54]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |