Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT46_RS06140 | Genome accession | NZ_CP035453 |
| Coordinates | 1179988..1180170 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain emm100 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1179988..1219157 | 1179988..1180170 | within | 0 |
Gene organization within MGE regions
Location: 1179988..1219157
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT46_RS06140 (ETT46_06135) | prx | 1179988..1180170 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| ETT46_RS06145 (ETT46_06140) | mf2 | 1180410..1181168 (+) | 759 | WP_014635573.1 | DNase Mf2 | - |
| ETT46_RS06150 (ETT46_06145) | speC | 1181279..1181986 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ETT46_RS06155 (ETT46_06150) | - | 1182055..1183272 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| ETT46_RS06160 (ETT46_06155) | - | 1183391..1183618 (-) | 228 | WP_003058873.1 | phage holin | - |
| ETT46_RS06165 (ETT46_06160) | - | 1183615..1183887 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT46_RS06170 (ETT46_06165) | - | 1183899..1184531 (-) | 633 | WP_011017396.1 | hypothetical protein | - |
| ETT46_RS06175 (ETT46_06170) | - | 1184534..1184962 (-) | 429 | WP_111684763.1 | DUF1617 family protein | - |
| ETT46_RS06180 (ETT46_06175) | - | 1184974..1186758 (-) | 1785 | WP_136261404.1 | gp58-like family protein | - |
| ETT46_RS06185 (ETT46_06180) | hylP | 1186773..1187882 (-) | 1110 | WP_111703211.1 | hyaluronoglucosaminidase | - |
| ETT46_RS06190 (ETT46_06185) | - | 1187882..1189855 (-) | 1974 | WP_186789088.1 | phage tail spike protein | - |
| ETT46_RS06195 (ETT46_06190) | - | 1189837..1190532 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| ETT46_RS06200 (ETT46_06195) | - | 1190529..1192892 (-) | 2364 | WP_136021967.1 | hypothetical protein | - |
| ETT46_RS06205 (ETT46_06200) | - | 1192892..1193263 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ETT46_RS06210 (ETT46_06205) | - | 1193278..1193541 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT46_RS06215 (ETT46_06210) | - | 1193552..1194142 (-) | 591 | WP_063629038.1 | hypothetical protein | - |
| ETT46_RS06220 (ETT46_06215) | - | 1194158..1194493 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| ETT46_RS06225 (ETT46_06220) | - | 1194494..1194730 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ETT46_RS06230 (ETT46_06225) | - | 1194723..1195061 (-) | 339 | WP_136021968.1 | hypothetical protein | - |
| ETT46_RS06235 (ETT46_06230) | - | 1195024..1195443 (-) | 420 | WP_063662149.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT46_RS06240 (ETT46_06235) | - | 1195453..1195653 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT46_RS06245 (ETT46_06240) | - | 1195653..1196564 (-) | 912 | WP_129322662.1 | phage major capsid protein | - |
| ETT46_RS06250 (ETT46_06245) | - | 1196589..1197050 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ETT46_RS06255 (ETT46_06250) | - | 1197131..1198545 (-) | 1415 | Protein_1174 | terminase | - |
| ETT46_RS06260 (ETT46_06255) | - | 1198627..1198863 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| ETT46_RS06265 (ETT46_06260) | - | 1198865..1199131 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT46_RS09535 | - | 1199124..1199276 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| ETT46_RS06270 (ETT46_06265) | - | 1199353..1199577 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT46_RS06275 (ETT46_06270) | - | 1199583..1201076 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| ETT46_RS06280 (ETT46_06275) | - | 1201069..1202337 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| ETT46_RS06285 (ETT46_06280) | - | 1202334..1202690 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT46_RS06290 (ETT46_06285) | - | 1202839..1203183 (-) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| ETT46_RS06295 (ETT46_06290) | - | 1203290..1203709 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ETT46_RS06300 (ETT46_06295) | - | 1203976..1204611 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ETT46_RS06305 (ETT46_06300) | - | 1204613..1204897 (-) | 285 | WP_063629032.1 | hypothetical protein | - |
| ETT46_RS06310 (ETT46_06305) | - | 1204884..1205087 (-) | 204 | WP_063629031.1 | hypothetical protein | - |
| ETT46_RS06315 (ETT46_06310) | - | 1205074..1205586 (-) | 513 | Protein_1187 | hypothetical protein | - |
| ETT46_RS06320 (ETT46_06315) | - | 1205583..1205924 (-) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT46_RS06325 (ETT46_06320) | - | 1206102..1206899 (-) | 798 | WP_136021975.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ETT46_RS06330 (ETT46_06325) | - | 1206896..1207870 (-) | 975 | WP_038433487.1 | recombinase RecT | - |
| ETT46_RS06335 (ETT46_06330) | - | 1207873..1208202 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ETT46_RS06340 (ETT46_06335) | - | 1208258..1208464 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ETT46_RS06345 (ETT46_06340) | - | 1208473..1208613 (-) | 141 | WP_136048676.1 | hypothetical protein | - |
| ETT46_RS06350 (ETT46_06345) | - | 1208610..1208843 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| ETT46_RS06355 (ETT46_06350) | - | 1208824..1209210 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ETT46_RS09685 (ETT46_06355) | - | 1209351..1209620 (-) | 270 | WP_011106700.1 | replication protein | - |
| ETT46_RS06365 (ETT46_06360) | - | 1209714..1209899 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| ETT46_RS06370 (ETT46_06365) | - | 1209901..1210212 (-) | 312 | WP_010922478.1 | excisionase | - |
| ETT46_RS06375 (ETT46_06370) | - | 1210482..1210694 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ETT46_RS06380 (ETT46_06375) | - | 1210896..1211651 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ETT46_RS06385 (ETT46_06380) | - | 1211663..1212181 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ETT46_RS06390 (ETT46_06385) | - | 1212305..1213447 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT46_RS06395 (ETT46_06390) | - | 1213536..1213811 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT46_RS06400 (ETT46_06395) | - | 1213910..1214497 (-) | 588 | WP_136265213.1 | YpmS family protein | - |
| ETT46_RS06405 (ETT46_06400) | - | 1214475..1215317 (-) | 843 | WP_168391515.1 | SGNH/GDSL hydrolase family protein | - |
| ETT46_RS06410 (ETT46_06405) | - | 1215310..1216149 (-) | 840 | WP_002989125.1 | DegV family protein | - |
| ETT46_RS06415 (ETT46_06410) | - | 1216377..1217324 (-) | 948 | WP_136110307.1 | LPXTG cell wall anchor domain-containing protein | - |
| ETT46_RS06420 (ETT46_06415) | recN | 1217496..1219157 (-) | 1662 | WP_085613973.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=342415 ETT46_RS06140 WP_014635572.1 1179988..1180170(-) (prx) [Streptococcus pyogenes strain emm100]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=342415 ETT46_RS06140 WP_014635572.1 1179988..1180170(-) (prx) [Streptococcus pyogenes strain emm100]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |