Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT50_RS05080 | Genome accession | NZ_CP035449 |
| Coordinates | 984616..984798 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain emm56 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 982221..1024207 | 984616..984798 | within | 0 |
Gene organization within MGE regions
Location: 982221..1024207
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT50_RS05070 (ETT50_05070) | slc2 | 982221..983522 (-) | 1302 | WP_146708729.1 | LPXTG-anchored collagen-like adhesin Scl2/SclB | - |
| ETT50_RS05075 (ETT50_05075) | - | 983869..984384 (-) | 516 | Protein_922 | elongation factor 4 | - |
| ETT50_RS05080 (ETT50_05080) | prx | 984616..984798 (-) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| ETT50_RS05085 (ETT50_05085) | - | 984997..985206 (-) | 210 | WP_011054450.1 | helix-turn-helix domain-containing protein | - |
| ETT50_RS09430 | - | 985360..985506 (+) | 147 | WP_011054449.1 | hypothetical protein | - |
| ETT50_RS05090 (ETT50_05090) | - | 985647..985898 (+) | 252 | WP_011054448.1 | hypothetical protein | - |
| ETT50_RS05095 (ETT50_05095) | - | 986162..986401 (+) | 240 | WP_011054447.1 | hypothetical protein | - |
| ETT50_RS05100 (ETT50_05100) | - | 986459..986815 (+) | 357 | WP_011054446.1 | hypothetical protein | - |
| ETT50_RS05105 (ETT50_05105) | - | 986931..988139 (-) | 1209 | WP_032465153.1 | glucosaminidase domain-containing protein | - |
| ETT50_RS05110 (ETT50_05110) | - | 988250..988435 (-) | 186 | WP_002990010.1 | holin | - |
| ETT50_RS05115 (ETT50_05115) | - | 988432..988728 (-) | 297 | WP_002990012.1 | hypothetical protein | - |
| ETT50_RS05120 (ETT50_05120) | - | 988739..989371 (-) | 633 | WP_032465154.1 | hypothetical protein | - |
| ETT50_RS05125 (ETT50_05125) | - | 989374..989802 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ETT50_RS05130 (ETT50_05130) | - | 989814..991700 (-) | 1887 | WP_146708730.1 | gp58-like family protein | - |
| ETT50_RS05135 (ETT50_05135) | hylP | 991715..992731 (-) | 1017 | WP_032464987.1 | hyaluronidase HylP | - |
| ETT50_RS05140 (ETT50_05140) | - | 992731..994779 (-) | 2049 | WP_032464986.1 | phage tail spike protein | - |
| ETT50_RS05145 (ETT50_05145) | - | 994776..995546 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| ETT50_RS05150 (ETT50_05150) | - | 995559..999659 (-) | 4101 | WP_032464985.1 | phage tail tape measure protein | - |
| ETT50_RS05160 (ETT50_05160) | gpG | 999885..1000187 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| ETT50_RS05165 (ETT50_05165) | - | 1000280..1000864 (-) | 585 | WP_011017389.1 | major tail protein | - |
| ETT50_RS05170 (ETT50_05170) | - | 1000876..1001256 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| ETT50_RS05175 (ETT50_05175) | - | 1001249..1001647 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| ETT50_RS05180 (ETT50_05180) | - | 1001649..1002011 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| ETT50_RS05185 (ETT50_05185) | - | 1002004..1002312 (-) | 309 | WP_011017385.1 | hypothetical protein | - |
| ETT50_RS09435 | - | 1002312..1002485 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| ETT50_RS05190 (ETT50_05190) | - | 1002499..1003632 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| ETT50_RS05195 (ETT50_05195) | - | 1003649..1004455 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| ETT50_RS05200 (ETT50_05200) | - | 1004436..1005623 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| ETT50_RS05205 (ETT50_05205) | - | 1005776..1005988 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| ETT50_RS05210 (ETT50_05210) | - | 1005991..1007721 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| ETT50_RS05215 (ETT50_05215) | - | 1007734..1008051 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| ETT50_RS05220 (ETT50_05220) | - | 1008192..1008497 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| ETT50_RS05225 (ETT50_05225) | - | 1008490..1008876 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| ETT50_RS05230 (ETT50_05230) | - | 1008902..1009105 (-) | 204 | WP_032464984.1 | hypothetical protein | - |
| ETT50_RS05235 (ETT50_05235) | - | 1009163..1009456 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| ETT50_RS05240 (ETT50_05240) | - | 1009610..1010185 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| ETT50_RS05245 (ETT50_05245) | - | 1010345..1010746 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| ETT50_RS05250 (ETT50_05250) | - | 1010761..1011588 (-) | 828 | WP_011017372.1 | prohibitin family protein | - |
| ETT50_RS05255 (ETT50_05255) | - | 1011590..1011928 (-) | 339 | WP_011017371.1 | helix-turn-helix domain-containing protein | - |
| ETT50_RS05260 (ETT50_05260) | - | 1011925..1012206 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| ETT50_RS05265 (ETT50_05265) | ssbA | 1012221..1012613 (-) | 393 | WP_011017370.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT50_RS05270 (ETT50_05270) | - | 1012610..1012831 (-) | 222 | WP_011017369.1 | hypothetical protein | - |
| ETT50_RS05275 (ETT50_05275) | - | 1012828..1013307 (-) | 480 | WP_032464990.1 | DUF1642 domain-containing protein | - |
| ETT50_RS05280 (ETT50_05280) | - | 1013312..1013944 (-) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| ETT50_RS05285 (ETT50_05285) | - | 1013946..1014230 (-) | 285 | WP_032464983.1 | hypothetical protein | - |
| ETT50_RS05290 (ETT50_05290) | - | 1014240..1014509 (-) | 270 | WP_023610894.1 | hypothetical protein | - |
| ETT50_RS05295 (ETT50_05295) | - | 1014526..1014732 (-) | 207 | WP_011054425.1 | hypothetical protein | - |
| ETT50_RS05300 (ETT50_05300) | - | 1014746..1014973 (-) | 228 | WP_011054424.1 | hypothetical protein | - |
| ETT50_RS05305 (ETT50_05305) | - | 1014973..1015785 (-) | 813 | WP_032464982.1 | ATP-binding protein | - |
| ETT50_RS05310 (ETT50_05310) | - | 1015785..1016549 (-) | 765 | WP_032464981.1 | conserved phage C-terminal domain-containing protein | - |
| ETT50_RS05315 (ETT50_05315) | dnaB | 1016542..1017882 (-) | 1341 | WP_032464980.1 | replicative DNA helicase | - |
| ETT50_RS05320 (ETT50_05320) | - | 1017869..1018057 (-) | 189 | WP_032464979.1 | hypothetical protein | - |
| ETT50_RS05325 (ETT50_05325) | - | 1018178..1018369 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| ETT50_RS05330 (ETT50_05330) | - | 1018462..1018719 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| ETT50_RS05335 (ETT50_05335) | - | 1018793..1019512 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| ETT50_RS05340 (ETT50_05340) | - | 1019564..1020064 (+) | 501 | WP_032464978.1 | hypothetical protein | - |
| ETT50_RS09545 | - | 1020184..1020318 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| ETT50_RS05345 (ETT50_05345) | - | 1020392..1020604 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| ETT50_RS05350 (ETT50_05350) | - | 1020639..1020914 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| ETT50_RS05355 (ETT50_05355) | - | 1021203..1021553 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| ETT50_RS05360 (ETT50_05360) | - | 1021557..1021949 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT50_RS05365 (ETT50_05365) | - | 1021960..1022700 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ETT50_RS05370 (ETT50_05370) | - | 1023011..1024207 (+) | 1197 | WP_011017350.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=342193 ETT50_RS05080 WP_029714017.1 984616..984798(-) (prx) [Streptococcus pyogenes strain emm56]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=342193 ETT50_RS05080 WP_029714017.1 984616..984798(-) (prx) [Streptococcus pyogenes strain emm56]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |