Detailed information    

insolico Bioinformatically predicted

Overview


Name   prx   Type   Regulator
Locus tag   ETT52_RS06220 Genome accession   NZ_CP035447
Coordinates   1237065..1237247 (-) Length   60 a.a.
NCBI ID   WP_136040097.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain emm97.1     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1237065..1278854 1237065..1237247 within 0


Gene organization within MGE regions


Location: 1237065..1278854
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ETT52_RS06220 (ETT52_06210) prx 1237065..1237247 (-) 183 WP_136040097.1 Paratox Regulator
  ETT52_RS06225 (ETT52_06215) - 1237441..1237650 (-) 210 WP_048327315.1 helix-turn-helix domain-containing protein -
  ETT52_RS09215 - 1237804..1237950 (+) 147 WP_164406938.1 hypothetical protein -
  ETT52_RS06230 (ETT52_06220) - 1238091..1238342 (+) 252 WP_048327312.1 hypothetical protein -
  ETT52_RS06235 (ETT52_06225) - 1238464..1239264 (+) 801 WP_136058973.1 recombinase family protein -
  ETT52_RS06240 (ETT52_06230) - 1239384..1240250 (-) 867 WP_011054729.1 DUF334 domain-containing protein -
  ETT52_RS06245 (ETT52_06235) - 1240238..1240762 (-) 525 WP_011017840.1 Panacea domain-containing protein -
  ETT52_RS06250 (ETT52_06240) - 1240902..1242107 (-) 1206 Protein_1161 glucosaminidase domain-containing protein -
  ETT52_RS06255 (ETT52_06245) - 1242223..1242450 (-) 228 WP_000609113.1 phage holin -
  ETT52_RS06260 (ETT52_06250) - 1242447..1242719 (-) 273 WP_011017397.1 hypothetical protein -
  ETT52_RS06265 (ETT52_06255) - 1242731..1243342 (-) 612 WP_136109104.1 DUF1366 domain-containing protein -
  ETT52_RS06270 (ETT52_06260) - 1243345..1243506 (-) 162 WP_012560658.1 hypothetical protein -
  ETT52_RS06275 (ETT52_06265) - 1243515..1245404 (-) 1890 WP_136109103.1 gp58-like family protein -
  ETT52_RS06280 (ETT52_06270) hylP 1245417..1246442 (-) 1026 WP_136109102.1 hyaluronidase HylP -
  ETT52_RS06285 (ETT52_06275) - 1246439..1248547 (-) 2109 WP_136109101.1 phage tail spike protein -
  ETT52_RS06290 (ETT52_06280) - 1248544..1249314 (-) 771 WP_136109100.1 distal tail protein Dit -
  ETT52_RS06295 (ETT52_06285) - 1249314..1252061 (-) 2748 WP_136109099.1 phage tail tape measure protein -
  ETT52_RS06300 (ETT52_06290) - 1252062..1252379 (-) 318 WP_136059197.1 hypothetical protein -
  ETT52_RS06305 (ETT52_06295) - 1252400..1252768 (-) 369 WP_136059196.1 tail assembly chaperone -
  ETT52_RS06310 (ETT52_06300) - 1252817..1253347 (-) 531 WP_136059195.1 phage major tail protein, TP901-1 family -
  ETT52_RS06315 (ETT52_06305) - 1253348..1253734 (-) 387 WP_136059194.1 DUF3168 domain-containing protein -
  ETT52_RS06320 (ETT52_06310) - 1253731..1254087 (-) 357 WP_136109098.1 HK97-gp10 family putative phage morphogenesis protein -
  ETT52_RS06325 (ETT52_06315) - 1254087..1254383 (-) 297 WP_002992595.1 hypothetical protein -
  ETT52_RS06330 (ETT52_06320) - 1254380..1254733 (-) 354 WP_002992594.1 phage head-tail connector protein -
  ETT52_RS06335 (ETT52_06325) - 1254743..1255012 (-) 270 WP_136040110.1 HeH/LEM domain-containing protein -
  ETT52_RS06340 (ETT52_06330) - 1255024..1256073 (-) 1050 WP_136040111.1 major capsid protein -
  ETT52_RS06345 (ETT52_06335) - 1256076..1256456 (-) 381 WP_002990036.1 structural protein -
  ETT52_RS06350 (ETT52_06340) - 1256466..1256999 (-) 534 WP_136040112.1 DUF4355 domain-containing protein -
  ETT52_RS06355 (ETT52_06345) - 1257143..1257409 (-) 267 WP_030127435.1 hypothetical protein -
  ETT52_RS06360 (ETT52_06350) - 1257425..1258291 (-) 867 WP_227878257.1 minor capsid protein -
  ETT52_RS06365 (ETT52_06355) - 1258320..1259810 (-) 1491 WP_136040114.1 phage portal protein -
  ETT52_RS06370 (ETT52_06360) - 1259822..1261066 (-) 1245 WP_023611361.1 PBSX family phage terminase large subunit -
  ETT52_RS06375 (ETT52_06365) - 1261063..1261512 (-) 450 WP_281726933.1 hypothetical protein -
  ETT52_RS06380 (ETT52_06370) - 1261562..1261939 (-) 378 WP_002986841.1 ASCH domain-containing protein -
  ETT52_RS06385 (ETT52_06375) - 1262000..1262476 (-) 477 WP_175399898.1 GNAT family N-acetyltransferase -
  ETT52_RS06390 (ETT52_06380) - 1262392..1263069 (-) 678 WP_002986850.1 ABC transporter ATP-binding protein -
  ETT52_RS06395 (ETT52_06385) - 1263048..1263566 (-) 519 WP_136040116.1 ParB N-terminal domain-containing protein -
  ETT52_RS09270 - 1263646..1263834 (+) 189 WP_153276769.1 hypothetical protein -
  ETT52_RS06415 (ETT52_06405) - 1264552..1264992 (-) 441 WP_136109162.1 ArpU family phage packaging/lysis transcriptional regulator -
  ETT52_RS06425 (ETT52_06415) - 1265265..1265636 (-) 372 WP_136040119.1 hypothetical protein -
  ETT52_RS06430 (ETT52_06420) - 1265633..1266136 (-) 504 WP_136040120.1 DUF1642 domain-containing protein -
  ETT52_RS06435 (ETT52_06425) - 1266133..1266426 (-) 294 WP_136019648.1 hypothetical protein -
  ETT52_RS06440 (ETT52_06430) - 1266423..1266608 (-) 186 WP_011054812.1 hypothetical protein -
  ETT52_RS06445 (ETT52_06435) - 1266633..1266860 (-) 228 WP_021340166.1 hypothetical protein -
  ETT52_RS06450 (ETT52_06440) - 1266864..1267349 (-) 486 WP_136109096.1 class I SAM-dependent methyltransferase -
  ETT52_RS06455 (ETT52_06445) - 1267337..1267687 (-) 351 WP_136040122.1 hypothetical protein -
  ETT52_RS06460 (ETT52_06450) - 1267690..1267974 (-) 285 WP_136040123.1 hypothetical protein -
  ETT52_RS09220 - 1267971..1268141 (-) 171 WP_011018135.1 hypothetical protein -
  ETT52_RS06465 (ETT52_06455) - 1268138..1268551 (-) 414 WP_085577344.1 YopX family protein -
  ETT52_RS06470 (ETT52_06460) - 1268535..1268822 (-) 288 WP_023078268.1 nucleotide modification associated domain-containing protein -
  ETT52_RS09505 (ETT52_06465) - 1268822..1269067 (-) 246 WP_038432522.1 hypothetical protein -
  ETT52_RS06480 (ETT52_06470) - 1269064..1269420 (-) 357 WP_136040125.1 hypothetical protein -
  ETT52_RS06485 (ETT52_06475) - 1269417..1269857 (-) 441 WP_136040126.1 RusA family crossover junction endodeoxyribonuclease -
  ETT52_RS06490 (ETT52_06480) - 1269857..1270060 (-) 204 WP_011106686.1 hypothetical protein -
  ETT52_RS06495 (ETT52_06485) ssbA 1270066..1270485 (-) 420 WP_011054759.1 single-stranded DNA-binding protein Machinery gene
  ETT52_RS06500 (ETT52_06490) - 1270478..1271152 (-) 675 WP_111713673.1 ERF family protein -
  ETT52_RS06505 (ETT52_06495) - 1271153..1271635 (-) 483 WP_011285577.1 siphovirus Gp157 family protein -
  ETT52_RS06510 (ETT52_06500) - 1271657..1271911 (-) 255 WP_021341161.1 hypothetical protein -
  ETT52_RS06515 (ETT52_06505) - 1271892..1272248 (-) 357 WP_021341157.1 HTH domain-containing protein -
  ETT52_RS09225 - 1272259..1272396 (-) 138 WP_011018145.1 hypothetical protein -
  ETT52_RS06520 (ETT52_06510) - 1272387..1273169 (-) 783 WP_136040127.1 ATP-binding protein -
  ETT52_RS06525 (ETT52_06515) - 1273156..1273917 (-) 762 WP_014635613.1 DnaD domain protein -
  ETT52_RS09425 - 1274039..1274173 (-) 135 WP_023611229.1 hypothetical protein -
  ETT52_RS06530 (ETT52_06520) - 1274204..1274455 (-) 252 WP_011888682.1 AlpA family transcriptional regulator -
  ETT52_RS09230 - 1274695..1274862 (-) 168 WP_021340232.1 hypothetical protein -
  ETT52_RS06540 (ETT52_06530) - 1274866..1275588 (-) 723 WP_032460391.1 phage antirepressor KilAC domain-containing protein -
  ETT52_RS06545 (ETT52_06535) - 1275639..1275866 (-) 228 WP_002990088.1 hypothetical protein -
  ETT52_RS06550 (ETT52_06540) - 1276026..1276781 (+) 756 WP_136040128.1 XRE family transcriptional regulator -
  ETT52_RS06555 (ETT52_06545) - 1276819..1277499 (+) 681 WP_002990092.1 hypothetical protein -
  ETT52_RS06560 (ETT52_06550) - 1277688..1278854 (+) 1167 WP_011018152.1 site-specific integrase -

Sequence


Protein


Download         Length: 60 a.a.        Molecular weight: 6934.91 Da        Isoelectric Point: 4.1220

>NTDB_id=342083 ETT52_RS06220 WP_136040097.1 1237065..1237247(-) (prx) [Streptococcus pyogenes strain emm97.1]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEVVEEVMVELDK

Nucleotide


Download         Length: 183 bp        

>NTDB_id=342083 ETT52_RS06220 WP_136040097.1 1237065..1237247(-) (prx) [Streptococcus pyogenes strain emm97.1]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS8232

85

100

0.85

  prx Streptococcus pyogenes MGAS315

85

100

0.85

  prx Streptococcus pyogenes MGAS315

83.333

100

0.833

  prx Streptococcus pyogenes MGAS315

83.333

100

0.833

  prx Streptococcus pyogenes MGAS315

81.667

100

0.817

  prx Streptococcus pyogenes MGAS315

86.047

71.667

0.617

  prx Streptococcus pyogenes MGAS315

76.19

70

0.533


Multiple sequence alignment