Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT52_RS06220 | Genome accession | NZ_CP035447 |
| Coordinates | 1237065..1237247 (-) | Length | 60 a.a. |
| NCBI ID | WP_136040097.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm97.1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1237065..1278854 | 1237065..1237247 | within | 0 |
Gene organization within MGE regions
Location: 1237065..1278854
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT52_RS06220 (ETT52_06210) | prx | 1237065..1237247 (-) | 183 | WP_136040097.1 | Paratox | Regulator |
| ETT52_RS06225 (ETT52_06215) | - | 1237441..1237650 (-) | 210 | WP_048327315.1 | helix-turn-helix domain-containing protein | - |
| ETT52_RS09215 | - | 1237804..1237950 (+) | 147 | WP_164406938.1 | hypothetical protein | - |
| ETT52_RS06230 (ETT52_06220) | - | 1238091..1238342 (+) | 252 | WP_048327312.1 | hypothetical protein | - |
| ETT52_RS06235 (ETT52_06225) | - | 1238464..1239264 (+) | 801 | WP_136058973.1 | recombinase family protein | - |
| ETT52_RS06240 (ETT52_06230) | - | 1239384..1240250 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| ETT52_RS06245 (ETT52_06235) | - | 1240238..1240762 (-) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ETT52_RS06250 (ETT52_06240) | - | 1240902..1242107 (-) | 1206 | Protein_1161 | glucosaminidase domain-containing protein | - |
| ETT52_RS06255 (ETT52_06245) | - | 1242223..1242450 (-) | 228 | WP_000609113.1 | phage holin | - |
| ETT52_RS06260 (ETT52_06250) | - | 1242447..1242719 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT52_RS06265 (ETT52_06255) | - | 1242731..1243342 (-) | 612 | WP_136109104.1 | DUF1366 domain-containing protein | - |
| ETT52_RS06270 (ETT52_06260) | - | 1243345..1243506 (-) | 162 | WP_012560658.1 | hypothetical protein | - |
| ETT52_RS06275 (ETT52_06265) | - | 1243515..1245404 (-) | 1890 | WP_136109103.1 | gp58-like family protein | - |
| ETT52_RS06280 (ETT52_06270) | hylP | 1245417..1246442 (-) | 1026 | WP_136109102.1 | hyaluronidase HylP | - |
| ETT52_RS06285 (ETT52_06275) | - | 1246439..1248547 (-) | 2109 | WP_136109101.1 | phage tail spike protein | - |
| ETT52_RS06290 (ETT52_06280) | - | 1248544..1249314 (-) | 771 | WP_136109100.1 | distal tail protein Dit | - |
| ETT52_RS06295 (ETT52_06285) | - | 1249314..1252061 (-) | 2748 | WP_136109099.1 | phage tail tape measure protein | - |
| ETT52_RS06300 (ETT52_06290) | - | 1252062..1252379 (-) | 318 | WP_136059197.1 | hypothetical protein | - |
| ETT52_RS06305 (ETT52_06295) | - | 1252400..1252768 (-) | 369 | WP_136059196.1 | tail assembly chaperone | - |
| ETT52_RS06310 (ETT52_06300) | - | 1252817..1253347 (-) | 531 | WP_136059195.1 | phage major tail protein, TP901-1 family | - |
| ETT52_RS06315 (ETT52_06305) | - | 1253348..1253734 (-) | 387 | WP_136059194.1 | DUF3168 domain-containing protein | - |
| ETT52_RS06320 (ETT52_06310) | - | 1253731..1254087 (-) | 357 | WP_136109098.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT52_RS06325 (ETT52_06315) | - | 1254087..1254383 (-) | 297 | WP_002992595.1 | hypothetical protein | - |
| ETT52_RS06330 (ETT52_06320) | - | 1254380..1254733 (-) | 354 | WP_002992594.1 | phage head-tail connector protein | - |
| ETT52_RS06335 (ETT52_06325) | - | 1254743..1255012 (-) | 270 | WP_136040110.1 | HeH/LEM domain-containing protein | - |
| ETT52_RS06340 (ETT52_06330) | - | 1255024..1256073 (-) | 1050 | WP_136040111.1 | major capsid protein | - |
| ETT52_RS06345 (ETT52_06335) | - | 1256076..1256456 (-) | 381 | WP_002990036.1 | structural protein | - |
| ETT52_RS06350 (ETT52_06340) | - | 1256466..1256999 (-) | 534 | WP_136040112.1 | DUF4355 domain-containing protein | - |
| ETT52_RS06355 (ETT52_06345) | - | 1257143..1257409 (-) | 267 | WP_030127435.1 | hypothetical protein | - |
| ETT52_RS06360 (ETT52_06350) | - | 1257425..1258291 (-) | 867 | WP_227878257.1 | minor capsid protein | - |
| ETT52_RS06365 (ETT52_06355) | - | 1258320..1259810 (-) | 1491 | WP_136040114.1 | phage portal protein | - |
| ETT52_RS06370 (ETT52_06360) | - | 1259822..1261066 (-) | 1245 | WP_023611361.1 | PBSX family phage terminase large subunit | - |
| ETT52_RS06375 (ETT52_06365) | - | 1261063..1261512 (-) | 450 | WP_281726933.1 | hypothetical protein | - |
| ETT52_RS06380 (ETT52_06370) | - | 1261562..1261939 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| ETT52_RS06385 (ETT52_06375) | - | 1262000..1262476 (-) | 477 | WP_175399898.1 | GNAT family N-acetyltransferase | - |
| ETT52_RS06390 (ETT52_06380) | - | 1262392..1263069 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| ETT52_RS06395 (ETT52_06385) | - | 1263048..1263566 (-) | 519 | WP_136040116.1 | ParB N-terminal domain-containing protein | - |
| ETT52_RS09270 | - | 1263646..1263834 (+) | 189 | WP_153276769.1 | hypothetical protein | - |
| ETT52_RS06415 (ETT52_06405) | - | 1264552..1264992 (-) | 441 | WP_136109162.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT52_RS06425 (ETT52_06415) | - | 1265265..1265636 (-) | 372 | WP_136040119.1 | hypothetical protein | - |
| ETT52_RS06430 (ETT52_06420) | - | 1265633..1266136 (-) | 504 | WP_136040120.1 | DUF1642 domain-containing protein | - |
| ETT52_RS06435 (ETT52_06425) | - | 1266133..1266426 (-) | 294 | WP_136019648.1 | hypothetical protein | - |
| ETT52_RS06440 (ETT52_06430) | - | 1266423..1266608 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| ETT52_RS06445 (ETT52_06435) | - | 1266633..1266860 (-) | 228 | WP_021340166.1 | hypothetical protein | - |
| ETT52_RS06450 (ETT52_06440) | - | 1266864..1267349 (-) | 486 | WP_136109096.1 | class I SAM-dependent methyltransferase | - |
| ETT52_RS06455 (ETT52_06445) | - | 1267337..1267687 (-) | 351 | WP_136040122.1 | hypothetical protein | - |
| ETT52_RS06460 (ETT52_06450) | - | 1267690..1267974 (-) | 285 | WP_136040123.1 | hypothetical protein | - |
| ETT52_RS09220 | - | 1267971..1268141 (-) | 171 | WP_011018135.1 | hypothetical protein | - |
| ETT52_RS06465 (ETT52_06455) | - | 1268138..1268551 (-) | 414 | WP_085577344.1 | YopX family protein | - |
| ETT52_RS06470 (ETT52_06460) | - | 1268535..1268822 (-) | 288 | WP_023078268.1 | nucleotide modification associated domain-containing protein | - |
| ETT52_RS09505 (ETT52_06465) | - | 1268822..1269067 (-) | 246 | WP_038432522.1 | hypothetical protein | - |
| ETT52_RS06480 (ETT52_06470) | - | 1269064..1269420 (-) | 357 | WP_136040125.1 | hypothetical protein | - |
| ETT52_RS06485 (ETT52_06475) | - | 1269417..1269857 (-) | 441 | WP_136040126.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT52_RS06490 (ETT52_06480) | - | 1269857..1270060 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ETT52_RS06495 (ETT52_06485) | ssbA | 1270066..1270485 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT52_RS06500 (ETT52_06490) | - | 1270478..1271152 (-) | 675 | WP_111713673.1 | ERF family protein | - |
| ETT52_RS06505 (ETT52_06495) | - | 1271153..1271635 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| ETT52_RS06510 (ETT52_06500) | - | 1271657..1271911 (-) | 255 | WP_021341161.1 | hypothetical protein | - |
| ETT52_RS06515 (ETT52_06505) | - | 1271892..1272248 (-) | 357 | WP_021341157.1 | HTH domain-containing protein | - |
| ETT52_RS09225 | - | 1272259..1272396 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| ETT52_RS06520 (ETT52_06510) | - | 1272387..1273169 (-) | 783 | WP_136040127.1 | ATP-binding protein | - |
| ETT52_RS06525 (ETT52_06515) | - | 1273156..1273917 (-) | 762 | WP_014635613.1 | DnaD domain protein | - |
| ETT52_RS09425 | - | 1274039..1274173 (-) | 135 | WP_023611229.1 | hypothetical protein | - |
| ETT52_RS06530 (ETT52_06520) | - | 1274204..1274455 (-) | 252 | WP_011888682.1 | AlpA family transcriptional regulator | - |
| ETT52_RS09230 | - | 1274695..1274862 (-) | 168 | WP_021340232.1 | hypothetical protein | - |
| ETT52_RS06540 (ETT52_06530) | - | 1274866..1275588 (-) | 723 | WP_032460391.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT52_RS06545 (ETT52_06535) | - | 1275639..1275866 (-) | 228 | WP_002990088.1 | hypothetical protein | - |
| ETT52_RS06550 (ETT52_06540) | - | 1276026..1276781 (+) | 756 | WP_136040128.1 | XRE family transcriptional regulator | - |
| ETT52_RS06555 (ETT52_06545) | - | 1276819..1277499 (+) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT52_RS06560 (ETT52_06550) | - | 1277688..1278854 (+) | 1167 | WP_011018152.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6934.91 Da Isoelectric Point: 4.1220
>NTDB_id=342083 ETT52_RS06220 WP_136040097.1 1237065..1237247(-) (prx) [Streptococcus pyogenes strain emm97.1]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEVVEEVMVELDK
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTEEVVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=342083 ETT52_RS06220 WP_136040097.1 1237065..1237247(-) (prx) [Streptococcus pyogenes strain emm97.1]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAAAATGGAGAAGTTGTGACCGAGGAGGTAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
81.667 |
100 |
0.817 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
71.667 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |