Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT54_RS04970 | Genome accession | NZ_CP035445 |
| Coordinates | 979333..979521 (-) | Length | 62 a.a. |
| NCBI ID | WP_136275039.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm92 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 971743..1019181 | 979333..979521 | within | 0 |
Gene organization within MGE regions
Location: 971743..1019181
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT54_RS04935 (ETT54_04930) | pfkA | 971743..972756 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| ETT54_RS04940 (ETT54_04935) | - | 972836..975946 (-) | 3111 | WP_129321873.1 | DNA polymerase III subunit alpha | - |
| ETT54_RS04945 (ETT54_04940) | - | 976131..976502 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| ETT54_RS04950 (ETT54_04945) | - | 976502..977200 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| ETT54_RS04955 (ETT54_04950) | - | 977210..977995 (+) | 786 | WP_002984433.1 | hypothetical protein | - |
| ETT54_RS04960 (ETT54_04955) | - | 978128..978742 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| ETT54_RS04970 (ETT54_04965) | prx | 979333..979521 (-) | 189 | WP_136275039.1 | Paratox | Regulator |
| ETT54_RS04975 (ETT54_04970) | speA | 979742..980497 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| ETT54_RS04980 (ETT54_04975) | - | 980619..981278 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| ETT54_RS04985 (ETT54_04980) | - | 981278..981499 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| ETT54_RS04990 (ETT54_04985) | - | 981509..982282 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| ETT54_RS04995 (ETT54_04990) | - | 982293..982895 (-) | 603 | WP_136282190.1 | hypothetical protein | - |
| ETT54_RS05000 (ETT54_04995) | - | 982907..983671 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| ETT54_RS05005 (ETT54_05000) | - | 983673..984005 (-) | 333 | WP_011054798.1 | phage holin | - |
| ETT54_RS05010 (ETT54_05005) | - | 984005..984328 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| ETT54_RS08975 | - | 984342..984464 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| ETT54_RS05015 (ETT54_05010) | - | 984478..984825 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| ETT54_RS05020 (ETT54_05015) | - | 984836..986698 (-) | 1863 | WP_136282189.1 | DUF859 family phage minor structural protein | - |
| ETT54_RS05025 (ETT54_05020) | - | 986703..990143 (-) | 3441 | WP_136282188.1 | glucosaminidase domain-containing protein | - |
| ETT54_RS05030 (ETT54_05025) | - | 990144..991628 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| ETT54_RS05035 (ETT54_05030) | - | 991629..993434 (-) | 1806 | WP_136298565.1 | phage tail protein | - |
| ETT54_RS05040 (ETT54_05035) | - | 993427..993885 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| ETT54_RS05045 (ETT54_05040) | - | 993858..994175 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| ETT54_RS05050 (ETT54_05045) | - | 994188..994694 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| ETT54_RS05055 (ETT54_05050) | - | 994706..995116 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| ETT54_RS05060 (ETT54_05055) | - | 995118..995513 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| ETT54_RS05065 (ETT54_05060) | - | 995510..995821 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| ETT54_RS05070 (ETT54_05065) | - | 995818..996162 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| ETT54_RS05075 (ETT54_05070) | - | 996176..996469 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| ETT54_RS05080 (ETT54_05075) | - | 996481..997371 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| ETT54_RS05085 (ETT54_05080) | - | 997389..997958 (-) | 570 | WP_136275041.1 | DUF4355 domain-containing protein | - |
| ETT54_RS05090 (ETT54_05085) | - | 998108..998374 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| ETT54_RS05095 (ETT54_05090) | - | 998381..999289 (-) | 909 | WP_136275042.1 | minor capsid protein | - |
| ETT54_RS05100 (ETT54_05095) | - | 999258..1000583 (-) | 1326 | WP_009880265.1 | phage portal protein | - |
| ETT54_RS05105 (ETT54_05100) | - | 1000583..1001857 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| ETT54_RS05110 (ETT54_05105) | - | 1001847..1002227 (-) | 381 | WP_136275043.1 | hypothetical protein | - |
| ETT54_RS05115 (ETT54_05110) | - | 1002576..1003010 (-) | 435 | WP_032461637.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT54_RS05120 (ETT54_05115) | - | 1003381..1003596 (-) | 216 | WP_227931355.1 | hypothetical protein | - |
| ETT54_RS05125 (ETT54_05120) | - | 1003765..1004514 (-) | 750 | WP_136098767.1 | DNA methyltransferase | - |
| ETT54_RS05130 (ETT54_05125) | - | 1004517..1004801 (-) | 285 | WP_111703185.1 | hypothetical protein | - |
| ETT54_RS05135 (ETT54_05130) | - | 1004798..1005184 (-) | 387 | WP_038433326.1 | YopX family protein | - |
| ETT54_RS05140 (ETT54_05135) | - | 1005198..1005467 (-) | 270 | WP_038433325.1 | hypothetical protein | - |
| ETT54_RS05145 (ETT54_05140) | - | 1005464..1005748 (-) | 285 | WP_136282186.1 | DUF3310 domain-containing protein | - |
| ETT54_RS09055 (ETT54_05145) | - | 1005742..1005993 (-) | 252 | WP_032459778.1 | hypothetical protein | - |
| ETT54_RS05155 (ETT54_05150) | - | 1005990..1006346 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| ETT54_RS05160 (ETT54_05155) | - | 1006343..1006783 (-) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT54_RS05165 (ETT54_05160) | - | 1006783..1006986 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| ETT54_RS05170 (ETT54_05165) | ssb | 1006992..1007483 (-) | 492 | WP_038433322.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT54_RS05175 (ETT54_05170) | - | 1007476..1008150 (-) | 675 | WP_136275045.1 | ERF family protein | - |
| ETT54_RS05180 (ETT54_05175) | - | 1008151..1008633 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ETT54_RS05185 (ETT54_05180) | - | 1008654..1008908 (-) | 255 | WP_032460177.1 | hypothetical protein | - |
| ETT54_RS05190 (ETT54_05185) | - | 1008889..1009245 (-) | 357 | WP_021341157.1 | HTH domain-containing protein | - |
| ETT54_RS08845 | - | 1009256..1009393 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| ETT54_RS05195 (ETT54_05190) | - | 1009393..1010235 (-) | 843 | WP_136117360.1 | ATP-binding protein | - |
| ETT54_RS05200 (ETT54_05195) | - | 1010245..1011150 (-) | 906 | WP_136117358.1 | phage replisome organizer N-terminal domain-containing protein | - |
| ETT54_RS05205 (ETT54_05200) | - | 1011164..1011478 (-) | 315 | WP_043885080.1 | helix-turn-helix domain-containing protein | - |
| ETT54_RS08980 | - | 1011494..1011628 (-) | 135 | WP_021340229.1 | hypothetical protein | - |
| ETT54_RS05210 (ETT54_05205) | - | 1011625..1011921 (-) | 297 | WP_021733370.1 | MerR family transcriptional regulator | - |
| ETT54_RS05215 (ETT54_05210) | - | 1011999..1012175 (-) | 177 | WP_002995990.1 | helix-turn-helix domain-containing protein | - |
| ETT54_RS05220 (ETT54_05215) | - | 1012318..1012539 (+) | 222 | WP_002992762.1 | hypothetical protein | - |
| ETT54_RS05225 (ETT54_05220) | - | 1012497..1012838 (-) | 342 | WP_030126640.1 | hypothetical protein | - |
| ETT54_RS05230 (ETT54_05225) | - | 1012855..1013310 (-) | 456 | WP_063629801.1 | ORF6C domain-containing protein | - |
| ETT54_RS05235 (ETT54_05230) | - | 1013307..1014230 (-) | 924 | WP_030126638.1 | hypothetical protein | - |
| ETT54_RS05240 (ETT54_05235) | - | 1014259..1014459 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| ETT54_RS05245 (ETT54_05240) | - | 1014553..1015095 (+) | 543 | WP_063629802.1 | hypothetical protein | - |
| ETT54_RS05250 (ETT54_05245) | - | 1015444..1016262 (+) | 819 | WP_063629803.1 | helix-turn-helix transcriptional regulator | - |
| ETT54_RS05255 (ETT54_05250) | - | 1016297..1016977 (+) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT54_RS05260 (ETT54_05255) | - | 1017110..1018198 (+) | 1089 | WP_038433317.1 | site-specific integrase | - |
| ETT54_RS05265 (ETT54_05260) | - | 1018561..1019181 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7266.32 Da Isoelectric Point: 4.1191
>NTDB_id=341973 ETT54_RS04970 WP_136275039.1 979333..979521(-) (prx) [Streptococcus pyogenes strain emm92]
MLYIDEFKEAIDKGYILGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLYIDEFKEAIDKGYILGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=341973 ETT54_RS04970 WP_136275039.1 979333..979521(-) (prx) [Streptococcus pyogenes strain emm92]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.935 |
100 |
0.919 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS8232 |
79.31 |
93.548 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
93.548 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
72.881 |
95.161 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
66.129 |
0.516 |