Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT56_RS03525 | Genome accession | NZ_CP035443 |
| Coordinates | 671149..671331 (+) | Length | 60 a.a. |
| NCBI ID | WP_063632461.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm58 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 636065..671331 | 671149..671331 | within | 0 |
Gene organization within MGE regions
Location: 636065..671331
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT56_RS03265 (ETT56_03265) | - | 636083..636925 (+) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| ETT56_RS03270 (ETT56_03270) | - | 636903..637490 (+) | 588 | WP_002989129.1 | YpmS family protein | - |
| ETT56_RS03275 (ETT56_03275) | - | 637589..637864 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT56_RS03280 (ETT56_03280) | - | 637953..639095 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT56_RS03285 (ETT56_03285) | - | 639219..639737 (-) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ETT56_RS03290 (ETT56_03290) | - | 639749..640504 (-) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ETT56_RS03295 (ETT56_03295) | - | 640706..640918 (+) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ETT56_RS09695 | - | 641071..641226 (-) | 156 | WP_153276859.1 | hypothetical protein | - |
| ETT56_RS03300 (ETT56_03300) | - | 641332..641643 (+) | 312 | WP_063632990.1 | hypothetical protein | - |
| ETT56_RS03305 (ETT56_03305) | - | 641645..641830 (+) | 186 | WP_010922477.1 | hypothetical protein | - |
| ETT56_RS09835 (ETT56_03310) | - | 641924..642193 (+) | 270 | WP_011106700.1 | replication protein | - |
| ETT56_RS03315 (ETT56_03315) | - | 642334..642720 (+) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ETT56_RS03320 (ETT56_03320) | - | 642701..642934 (+) | 234 | WP_010922205.1 | hypothetical protein | - |
| ETT56_RS03325 (ETT56_03325) | - | 642931..643071 (+) | 141 | WP_002988354.1 | hypothetical protein | - |
| ETT56_RS03330 (ETT56_03330) | - | 643080..643286 (+) | 207 | WP_002990074.1 | hypothetical protein | - |
| ETT56_RS03335 (ETT56_03335) | - | 643342..643671 (+) | 330 | WP_002988359.1 | hypothetical protein | - |
| ETT56_RS03340 (ETT56_03340) | bet | 643674..644465 (+) | 792 | WP_002990071.1 | phage recombination protein Bet | - |
| ETT56_RS03345 (ETT56_03345) | - | 644475..645503 (+) | 1029 | WP_002993808.1 | DUF1351 domain-containing protein | - |
| ETT56_RS03350 (ETT56_03350) | - | 645700..646041 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT56_RS03355 (ETT56_03355) | - | 646038..646550 (+) | 513 | WP_002988366.1 | hypothetical protein | - |
| ETT56_RS09700 | - | 646537..646707 (+) | 171 | WP_168419554.1 | hypothetical protein | - |
| ETT56_RS03360 (ETT56_03360) | - | 646726..647361 (+) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ETT56_RS03365 (ETT56_03365) | - | 647628..648047 (+) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ETT56_RS03370 (ETT56_03370) | - | 648154..648498 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| ETT56_RS03375 (ETT56_03375) | - | 648649..649005 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT56_RS03380 (ETT56_03380) | - | 649002..650270 (+) | 1269 | WP_011017979.1 | phage portal protein | - |
| ETT56_RS03385 (ETT56_03385) | - | 650263..651756 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| ETT56_RS03390 (ETT56_03390) | - | 651762..651986 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT56_RS03395 (ETT56_03395) | - | 652036..652215 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| ETT56_RS03400 (ETT56_03400) | - | 652208..652474 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT56_RS03405 (ETT56_03405) | - | 652476..652712 (+) | 237 | Protein_598 | hypothetical protein | - |
| ETT56_RS03410 (ETT56_03410) | - | 652794..654209 (+) | 1416 | WP_063632967.1 | hypothetical protein | - |
| ETT56_RS03415 (ETT56_03415) | - | 654289..654750 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ETT56_RS03420 (ETT56_03420) | - | 654775..655686 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| ETT56_RS03425 (ETT56_03425) | - | 655686..655886 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT56_RS03430 (ETT56_03430) | - | 655896..656318 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT56_RS03435 (ETT56_03435) | - | 656278..656616 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| ETT56_RS03440 (ETT56_03440) | - | 656609..656845 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| ETT56_RS03445 (ETT56_03445) | - | 656846..657181 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| ETT56_RS03450 (ETT56_03450) | - | 657197..657787 (+) | 591 | WP_053308478.1 | hypothetical protein | - |
| ETT56_RS03455 (ETT56_03455) | - | 657798..658061 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT56_RS03460 (ETT56_03460) | - | 658076..658447 (+) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ETT56_RS03465 (ETT56_03465) | - | 658447..660804 (+) | 2358 | WP_053308477.1 | hypothetical protein | - |
| ETT56_RS03470 (ETT56_03470) | - | 660801..661496 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| ETT56_RS03475 (ETT56_03475) | - | 661493..663451 (+) | 1959 | WP_053308476.1 | phage tail spike protein | - |
| ETT56_RS03480 (ETT56_03480) | - | 663451..664560 (+) | 1110 | WP_063632966.1 | hyaluronoglucosaminidase | - |
| ETT56_RS03485 (ETT56_03485) | - | 664575..666359 (+) | 1785 | WP_063632965.1 | gp58-like family protein | - |
| ETT56_RS03490 (ETT56_03490) | - | 666371..666802 (+) | 432 | WP_063632964.1 | DUF1617 family protein | - |
| ETT56_RS03495 (ETT56_03495) | - | 666805..667422 (+) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| ETT56_RS03500 (ETT56_03500) | - | 667432..667704 (+) | 273 | WP_019418840.1 | hypothetical protein | - |
| ETT56_RS03505 (ETT56_03505) | - | 667701..667928 (+) | 228 | WP_063632963.1 | phage holin | - |
| ETT56_RS03510 (ETT56_03510) | - | 668047..669264 (+) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| ETT56_RS03515 (ETT56_03515) | speC | 669333..670040 (-) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ETT56_RS03520 (ETT56_03520) | mf2 | 670151..670909 (-) | 759 | WP_014635573.1 | DNase Mf2 | - |
| ETT56_RS03525 (ETT56_03525) | prx | 671149..671331 (+) | 183 | WP_063632461.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7081.04 Da Isoelectric Point: 4.1079
>NTDB_id=341860 ETT56_RS03525 WP_063632461.1 671149..671331(+) (prx) [Streptococcus pyogenes strain emm58]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=341860 ETT56_RS03525 WP_063632461.1 671149..671331(+) (prx) [Streptococcus pyogenes strain emm58]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS8232 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
70 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |