Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT57_RS05995 | Genome accession | NZ_CP035442 |
| Coordinates | 1163321..1163503 (-) | Length | 60 a.a. |
| NCBI ID | WP_014635572.1 | Uniprot ID | A0A8B6J386 |
| Organism | Streptococcus pyogenes strain emm25 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1163321..1197130 | 1163321..1163503 | within | 0 |
Gene organization within MGE regions
Location: 1163321..1197130
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT57_RS05995 (ETT57_05985) | prx | 1163321..1163503 (-) | 183 | WP_014635572.1 | hypothetical protein | Regulator |
| ETT57_RS06000 (ETT57_05990) | mf2 | 1163743..1164501 (+) | 759 | WP_111684767.1 | DNase Mf2 | - |
| ETT57_RS06005 (ETT57_05995) | speC | 1164612..1165319 (+) | 708 | WP_002985327.1 | streptococcal pyrogenic exotoxin SpeC | - |
| ETT57_RS06010 (ETT57_06000) | - | 1165388..1166605 (-) | 1218 | WP_014635574.1 | peptidoglycan amidohydrolase family protein | - |
| ETT57_RS06015 (ETT57_06005) | - | 1166724..1166951 (-) | 228 | WP_003058873.1 | phage holin | - |
| ETT57_RS06020 (ETT57_06010) | - | 1166948..1167220 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT57_RS06025 (ETT57_06015) | - | 1167232..1167864 (-) | 633 | WP_011017396.1 | hypothetical protein | - |
| ETT57_RS06030 (ETT57_06020) | - | 1167867..1168295 (-) | 429 | WP_111684763.1 | DUF1617 family protein | - |
| ETT57_RS06035 (ETT57_06025) | - | 1168307..1170091 (-) | 1785 | WP_136048678.1 | gp58-like family protein | - |
| ETT57_RS06040 (ETT57_06030) | hylP | 1170106..1171215 (-) | 1110 | WP_136095883.1 | hyaluronoglucosaminidase | - |
| ETT57_RS06045 (ETT57_06035) | - | 1171215..1173188 (-) | 1974 | WP_168388764.1 | phage tail spike protein | - |
| ETT57_RS06050 (ETT57_06040) | - | 1173170..1173865 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| ETT57_RS06055 (ETT57_06045) | - | 1173862..1176225 (-) | 2364 | WP_136021967.1 | hypothetical protein | - |
| ETT57_RS06060 (ETT57_06050) | - | 1176225..1176596 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| ETT57_RS06065 (ETT57_06055) | - | 1176611..1176874 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT57_RS06070 (ETT57_06060) | - | 1176885..1177475 (-) | 591 | WP_063629038.1 | hypothetical protein | - |
| ETT57_RS06075 (ETT57_06065) | - | 1177491..1177826 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| ETT57_RS06080 (ETT57_06070) | - | 1177827..1178063 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| ETT57_RS06085 (ETT57_06075) | - | 1178056..1178394 (-) | 339 | WP_136021968.1 | hypothetical protein | - |
| ETT57_RS06090 (ETT57_06080) | - | 1178357..1178776 (-) | 420 | WP_063662149.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT57_RS06095 (ETT57_06085) | - | 1178786..1178986 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT57_RS06100 (ETT57_06090) | - | 1178986..1179897 (-) | 912 | WP_129322662.1 | phage major capsid protein | - |
| ETT57_RS06105 (ETT57_06095) | - | 1179922..1180383 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ETT57_RS06110 (ETT57_06100) | - | 1180464..1181879 (-) | 1416 | WP_136048677.1 | terminase | - |
| ETT57_RS06115 (ETT57_06105) | - | 1181961..1182197 (-) | 237 | WP_011888764.1 | hypothetical protein | - |
| ETT57_RS06120 (ETT57_06110) | - | 1182199..1182465 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT57_RS09450 | - | 1182458..1182610 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| ETT57_RS06125 (ETT57_06115) | - | 1182687..1182911 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT57_RS06130 (ETT57_06120) | - | 1182917..1184410 (-) | 1494 | WP_011017978.1 | hypothetical protein | - |
| ETT57_RS06135 (ETT57_06125) | - | 1184403..1185671 (-) | 1269 | WP_011017979.1 | phage portal protein | - |
| ETT57_RS06140 (ETT57_06130) | - | 1185668..1186024 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT57_RS06145 (ETT57_06135) | - | 1186173..1186517 (-) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| ETT57_RS06150 (ETT57_06140) | - | 1186624..1187043 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ETT57_RS06155 (ETT57_06145) | - | 1187310..1187945 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ETT57_RS06160 (ETT57_06150) | - | 1187947..1188231 (-) | 285 | WP_063629032.1 | hypothetical protein | - |
| ETT57_RS06165 (ETT57_06155) | - | 1188218..1188421 (-) | 204 | WP_063629031.1 | hypothetical protein | - |
| ETT57_RS06170 (ETT57_06160) | - | 1188408..1188920 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ETT57_RS06175 (ETT57_06165) | - | 1188917..1189258 (-) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT57_RS06180 (ETT57_06170) | - | 1189436..1190233 (-) | 798 | WP_136021975.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ETT57_RS06185 (ETT57_06175) | - | 1190230..1191204 (-) | 975 | WP_038433487.1 | recombinase RecT | - |
| ETT57_RS06190 (ETT57_06180) | - | 1191207..1191536 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ETT57_RS06195 (ETT57_06185) | - | 1191592..1191798 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| ETT57_RS06200 (ETT57_06190) | - | 1191807..1191947 (-) | 141 | WP_136048676.1 | hypothetical protein | - |
| ETT57_RS06205 (ETT57_06195) | - | 1191944..1192177 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| ETT57_RS06210 (ETT57_06200) | - | 1192158..1192544 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| ETT57_RS09615 (ETT57_06205) | - | 1192670..1192939 (-) | 270 | WP_011106700.1 | replication protein | - |
| ETT57_RS06220 (ETT57_06210) | - | 1193033..1193218 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| ETT57_RS06225 (ETT57_06215) | - | 1193220..1193531 (-) | 312 | WP_010922478.1 | excisionase | - |
| ETT57_RS06230 (ETT57_06220) | - | 1193801..1194013 (-) | 213 | WP_010922479.1 | helix-turn-helix domain-containing protein | - |
| ETT57_RS06235 (ETT57_06225) | - | 1194215..1194970 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| ETT57_RS06240 (ETT57_06230) | - | 1194982..1195500 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| ETT57_RS06245 (ETT57_06235) | - | 1195624..1196766 (+) | 1143 | WP_136048675.1 | site-specific integrase | - |
| ETT57_RS06250 (ETT57_06240) | - | 1196855..1197130 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7067.01 Da Isoelectric Point: 4.1079
>NTDB_id=341815 ETT57_RS05995 WP_014635572.1 1163321..1163503(-) (prx) [Streptococcus pyogenes strain emm25]
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
MLTYDEFKQAIDNGYITGDTVMIVRKNGQIFDYVLPNEKIRDWEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=341815 ETT57_RS05995 WP_014635572.1 1163321..1163503(-) (prx) [Streptococcus pyogenes strain emm25]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGACAACGGATATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCGAATGAGAAGATAAGAGATTGGGAGGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
70 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |