Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT57_RS04110 | Genome accession | NZ_CP035442 |
| Coordinates | 770027..770215 (+) | Length | 62 a.a. |
| NCBI ID | WP_136022789.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm25 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 729100..778607 | 770027..770215 | within | 0 |
Gene organization within MGE regions
Location: 729100..778607
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT57_RS03810 (ETT57_03800) | - | 729100..729693 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ETT57_RS03815 (ETT57_03805) | rfbB | 729938..730978 (+) | 1041 | WP_136048409.1 | dTDP-glucose 4,6-dehydratase | - |
| ETT57_RS03820 (ETT57_03810) | - | 731072..732211 (-) | 1140 | WP_002990094.1 | site-specific integrase | - |
| ETT57_RS03825 (ETT57_03815) | - | 732348..733028 (-) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT57_RS03830 (ETT57_03820) | - | 733066..733821 (-) | 756 | WP_002990090.1 | XRE family transcriptional regulator | - |
| ETT57_RS09420 | - | 734178..734327 (+) | 150 | WP_168389386.1 | hypothetical protein | - |
| ETT57_RS03840 (ETT57_03830) | - | 734316..734528 (-) | 213 | WP_136022811.1 | hypothetical protein | - |
| ETT57_RS03845 (ETT57_03835) | - | 734587..734745 (+) | 159 | WP_111711563.1 | hypothetical protein | - |
| ETT57_RS03850 (ETT57_03840) | - | 734879..735658 (-) | 780 | WP_136022810.1 | hypothetical protein | - |
| ETT57_RS03855 (ETT57_03845) | - | 735755..735982 (+) | 228 | WP_002990088.1 | hypothetical protein | - |
| ETT57_RS03860 (ETT57_03850) | - | 736033..736755 (+) | 723 | WP_032460391.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT57_RS03865 (ETT57_03855) | - | 736853..737092 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| ETT57_RS03870 (ETT57_03860) | - | 737259..737444 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ETT57_RS03875 (ETT57_03865) | - | 737523..737840 (+) | 318 | WP_063631315.1 | hypothetical protein | - |
| ETT57_RS03880 (ETT57_03870) | - | 737837..737974 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| ETT57_RS03885 (ETT57_03875) | - | 738055..738384 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| ETT57_RS03890 (ETT57_03880) | - | 738384..738578 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| ETT57_RS03895 (ETT57_03885) | - | 738575..738859 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| ETT57_RS03900 (ETT57_03890) | - | 738856..739539 (+) | 684 | WP_014635524.1 | AAA family ATPase | - |
| ETT57_RS03905 (ETT57_03895) | - | 739545..740978 (+) | 1434 | Protein_702 | DEAD/DEAH box helicase | - |
| ETT57_RS03910 (ETT57_03900) | - | 740983..741465 (+) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| ETT57_RS03915 (ETT57_03905) | - | 741483..743036 (+) | 1554 | WP_011017876.1 | hypothetical protein | - |
| ETT57_RS03920 (ETT57_03910) | - | 743303..744172 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| ETT57_RS03925 (ETT57_03915) | - | 744192..744476 (+) | 285 | WP_227874671.1 | VRR-NUC domain-containing protein | - |
| ETT57_RS03930 (ETT57_03920) | - | 744460..744816 (+) | 357 | WP_023078113.1 | hypothetical protein | - |
| ETT57_RS09705 (ETT57_03925) | - | 744813..745064 (+) | 252 | WP_136022808.1 | hypothetical protein | - |
| ETT57_RS03940 (ETT57_03930) | - | 745058..745309 (+) | 252 | WP_136022807.1 | DUF3310 domain-containing protein | - |
| ETT57_RS03945 (ETT57_03935) | - | 745266..745727 (+) | 462 | Protein_710 | N-6 DNA methylase | - |
| ETT57_RS03950 (ETT57_03940) | - | 746000..746440 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT57_RS03955 (ETT57_03945) | - | 746741..746914 (+) | 174 | WP_175393795.1 | hypothetical protein | - |
| ETT57_RS03960 (ETT57_03950) | - | 747033..747527 (+) | 495 | WP_136022806.1 | terminase small subunit | - |
| ETT57_RS03965 (ETT57_03955) | - | 747505..748812 (+) | 1308 | WP_136022805.1 | PBSX family phage terminase large subunit | - |
| ETT57_RS03970 (ETT57_03960) | - | 748824..750323 (+) | 1500 | WP_136022804.1 | phage portal protein | - |
| ETT57_RS03975 (ETT57_03965) | - | 750298..751218 (+) | 921 | WP_136022803.1 | minor capsid protein | - |
| ETT57_RS03980 (ETT57_03970) | - | 751233..751412 (+) | 180 | WP_050316441.1 | hypothetical protein | - |
| ETT57_RS03985 (ETT57_03975) | - | 751405..751674 (+) | 270 | WP_136022802.1 | hypothetical protein | - |
| ETT57_RS09660 | - | 751676..751810 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| ETT57_RS03990 (ETT57_03980) | - | 751904..752437 (+) | 534 | WP_046177710.1 | DUF4355 domain-containing protein | - |
| ETT57_RS03995 (ETT57_03985) | - | 752447..752848 (+) | 402 | WP_136022801.1 | head decoration protein | - |
| ETT57_RS04000 (ETT57_03990) | - | 752848..753933 (+) | 1086 | WP_136022800.1 | major capsid protein | - |
| ETT57_RS04005 (ETT57_03995) | - | 753943..754185 (+) | 243 | WP_063812977.1 | HeH/LEM domain-containing protein | - |
| ETT57_RS04010 (ETT57_04000) | - | 754199..754552 (+) | 354 | WP_063812978.1 | phage head-tail connector protein | - |
| ETT57_RS04015 (ETT57_04005) | - | 754549..754845 (+) | 297 | WP_136022799.1 | hypothetical protein | - |
| ETT57_RS04020 (ETT57_04010) | - | 754845..755201 (+) | 357 | WP_136022798.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT57_RS04025 (ETT57_04015) | - | 755198..755584 (+) | 387 | WP_063812981.1 | hypothetical protein | - |
| ETT57_RS04030 (ETT57_04020) | - | 755585..756145 (+) | 561 | WP_136022797.1 | phage major tail protein, TP901-1 family | - |
| ETT57_RS04035 (ETT57_04025) | - | 756158..756526 (+) | 369 | WP_136022796.1 | tail assembly chaperone | - |
| ETT57_RS09560 | - | 756664..756855 (+) | 192 | WP_227875247.1 | hypothetical protein | - |
| ETT57_RS04045 (ETT57_04035) | - | 756865..759864 (+) | 3000 | WP_136022795.1 | phage tail tape measure protein | - |
| ETT57_RS04050 (ETT57_04040) | - | 759864..760634 (+) | 771 | WP_136022794.1 | distal tail protein Dit | - |
| ETT57_RS04055 (ETT57_04045) | - | 760631..762742 (+) | 2112 | WP_136022793.1 | phage tail spike protein | - |
| ETT57_RS04060 (ETT57_04050) | - | 762739..763953 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ETT57_RS04065 (ETT57_04055) | - | 763955..764269 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ETT57_RS04070 (ETT57_04060) | - | 764280..766175 (+) | 1896 | WP_011284841.1 | gp58-like family protein | - |
| ETT57_RS04075 (ETT57_04065) | - | 766189..766350 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| ETT57_RS04080 (ETT57_04070) | - | 766353..766964 (+) | 612 | WP_136022792.1 | hypothetical protein | - |
| ETT57_RS04085 (ETT57_04075) | - | 766974..767270 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| ETT57_RS04090 (ETT57_04080) | - | 767267..767452 (+) | 186 | WP_002990010.1 | holin | - |
| ETT57_RS04095 (ETT57_04085) | - | 767564..768898 (+) | 1335 | WP_136095872.1 | GH25 family lysozyme | - |
| ETT57_RS04100 (ETT57_04090) | - | 769147..769422 (+) | 276 | WP_136022791.1 | hypothetical protein | - |
| ETT57_RS04105 (ETT57_04095) | - | 769424..769909 (+) | 486 | WP_136022790.1 | hypothetical protein | - |
| ETT57_RS04110 (ETT57_04100) | prx | 770027..770215 (+) | 189 | WP_136022789.1 | Paratox | Regulator |
| ETT57_RS04115 (ETT57_04105) | - | 770623..771099 (+) | 477 | WP_136048406.1 | 8-oxo-dGTP diphosphatase | - |
| ETT57_RS04120 (ETT57_04110) | - | 771157..772338 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| ETT57_RS04125 (ETT57_04115) | - | 772328..773575 (+) | 1248 | WP_136048405.1 | tetratricopeptide repeat protein | - |
| ETT57_RS04130 (ETT57_04120) | fbp54 | 773634..775286 (-) | 1653 | WP_014407524.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| ETT57_RS04135 (ETT57_04125) | trpX | 775640..776638 (+) | 999 | WP_023611161.1 | tryptophan ABC transporter substrate-binding protein | - |
| ETT57_RS04145 (ETT57_04135) | - | 776983..777852 (+) | 870 | WP_002991975.1 | ABC transporter permease | - |
| ETT57_RS04150 (ETT57_04140) | - | 777849..778607 (+) | 759 | WP_009880825.1 | ABC transporter ATP-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7268.17 Da Isoelectric Point: 3.9282
>NTDB_id=341809 ETT57_RS04110 WP_136022789.1 770027..770215(+) (prx) [Streptococcus pyogenes strain emm25]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=341809 ETT57_RS04110 WP_136022789.1 770027..770215(+) (prx) [Streptococcus pyogenes strain emm25]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
93.548 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS8232 |
72.881 |
95.161 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |