Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT58_RS07340 | Genome accession | NZ_CP035441 |
| Coordinates | 1407371..1407550 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain emm1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1407371..1447987 | 1407371..1407550 | within | 0 |
Gene organization within MGE regions
Location: 1407371..1447987
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT58_RS07340 (ETT58_07335) | prx | 1407371..1407550 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| ETT58_RS07345 (ETT58_07340) | sda1 | 1407789..1408961 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| ETT58_RS07350 (ETT58_07345) | - | 1409077..1410273 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| ETT58_RS07355 (ETT58_07350) | - | 1410384..1410569 (-) | 186 | WP_002988802.1 | holin | - |
| ETT58_RS07360 (ETT58_07355) | - | 1410566..1410865 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| ETT58_RS07365 (ETT58_07360) | - | 1410876..1411496 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| ETT58_RS07370 (ETT58_07365) | - | 1411499..1411660 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| ETT58_RS07375 (ETT58_07370) | - | 1411669..1413576 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| ETT58_RS07380 (ETT58_07375) | - | 1413587..1414222 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| ETT58_RS07385 (ETT58_07380) | - | 1414222..1415277 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| ETT58_RS07390 (ETT58_07385) | - | 1415274..1417256 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| ETT58_RS07395 (ETT58_07390) | - | 1417266..1418108 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| ETT58_RS07400 (ETT58_07395) | - | 1418120..1422502 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| ETT58_RS07405 (ETT58_07400) | - | 1422517..1422750 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| ETT58_RS07410 (ETT58_07405) | - | 1422825..1423280 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| ETT58_RS07415 (ETT58_07410) | - | 1423334..1423933 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| ETT58_RS07420 (ETT58_07415) | - | 1423945..1424304 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| ETT58_RS07425 (ETT58_07420) | - | 1424308..1424652 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT58_RS07430 (ETT58_07425) | - | 1424649..1424927 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| ETT58_RS07435 (ETT58_07430) | - | 1424938..1425294 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| ETT58_RS07440 (ETT58_07435) | - | 1425306..1426193 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| ETT58_RS07445 (ETT58_07440) | - | 1426206..1426775 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| ETT58_RS07450 (ETT58_07445) | - | 1426931..1427197 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| ETT58_RS07455 (ETT58_07450) | - | 1427200..1427388 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| ETT58_RS07460 (ETT58_07455) | - | 1427419..1428864 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| ETT58_RS07465 (ETT58_07460) | - | 1428824..1430356 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| ETT58_RS07470 (ETT58_07465) | - | 1430372..1431649 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| ETT58_RS07475 (ETT58_07470) | - | 1431639..1432091 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ETT58_RS07480 (ETT58_07475) | - | 1432181..1432597 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| ETT58_RS07485 (ETT58_07480) | - | 1432594..1432785 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| ETT58_RS07490 (ETT58_07485) | - | 1432775..1433626 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| ETT58_RS07495 (ETT58_07490) | - | 1433635..1433901 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| ETT58_RS09560 | - | 1433898..1434065 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| ETT58_RS07500 (ETT58_07495) | - | 1434066..1435388 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| ETT58_RS07505 (ETT58_07500) | - | 1435385..1435660 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| ETT58_RS07510 (ETT58_07505) | - | 1436047..1438431 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| ETT58_RS07515 (ETT58_07510) | - | 1438436..1440358 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| ETT58_RS07520 (ETT58_07515) | - | 1440401..1440958 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| ETT58_RS07525 (ETT58_07520) | - | 1440969..1441367 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| ETT58_RS07530 (ETT58_07525) | - | 1441371..1442525 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| ETT58_RS07535 (ETT58_07530) | - | 1442525..1442824 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| ETT58_RS07540 (ETT58_07535) | - | 1442912..1443115 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| ETT58_RS07545 (ETT58_07540) | - | 1443261..1443647 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| ETT58_RS07550 (ETT58_07545) | - | 1443644..1443847 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| ETT58_RS07555 (ETT58_07550) | - | 1443840..1444010 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| ETT58_RS07560 (ETT58_07555) | - | 1444007..1444282 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| ETT58_RS07565 (ETT58_07560) | - | 1444344..1444559 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| ETT58_RS07570 (ETT58_07565) | - | 1444607..1445020 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| ETT58_RS09565 | - | 1445001..1445156 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| ETT58_RS07575 (ETT58_07570) | - | 1445482..1445832 (+) | 351 | WP_002988676.1 | helix-turn-helix domain-containing protein | - |
| ETT58_RS07580 (ETT58_07575) | - | 1445846..1446229 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT58_RS07585 (ETT58_07580) | - | 1446240..1446791 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| ETT58_RS07590 (ETT58_07585) | - | 1446908..1447987 (+) | 1080 | WP_002988667.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=341762 ETT58_RS07340 WP_002988813.1 1407371..1407550(-) (prx) [Streptococcus pyogenes strain emm1]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=341762 ETT58_RS07340 WP_002988813.1 1407371..1407550(-) (prx) [Streptococcus pyogenes strain emm1]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |