Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT58_RS06050 | Genome accession | NZ_CP035441 |
| Coordinates | 1168782..1168964 (-) | Length | 60 a.a. |
| NCBI ID | WP_011017964.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm1 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1168782..1203792 | 1168782..1168964 | within | 0 |
Gene organization within MGE regions
Location: 1168782..1203792
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT58_RS06050 (ETT58_06045) | prx | 1168782..1168964 (-) | 183 | WP_011017964.1 | hypothetical protein | Regulator |
| ETT58_RS06055 (ETT58_06050) | sda3 | 1169203..1170003 (+) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| ETT58_RS06060 (ETT58_06055) | - | 1170274..1170708 (+) | 435 | WP_011017966.1 | hypothetical protein | - |
| ETT58_RS06065 (ETT58_06060) | - | 1170778..1171983 (-) | 1206 | WP_010922446.1 | glucosaminidase domain-containing protein | - |
| ETT58_RS06070 (ETT58_06065) | - | 1172099..1172326 (-) | 228 | WP_003058873.1 | phage holin | - |
| ETT58_RS06075 (ETT58_06070) | - | 1172323..1172598 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| ETT58_RS06080 (ETT58_06075) | - | 1172608..1173225 (-) | 618 | WP_011285613.1 | DUF1366 domain-containing protein | - |
| ETT58_RS06085 (ETT58_06080) | - | 1173222..1173659 (-) | 438 | WP_011285614.1 | DUF1617 family protein | - |
| ETT58_RS06090 (ETT58_06085) | - | 1173671..1175539 (-) | 1869 | WP_011285615.1 | gp58-like family protein | - |
| ETT58_RS06095 (ETT58_06090) | - | 1175536..1176231 (-) | 696 | WP_010922452.1 | hypothetical protein | - |
| ETT58_RS06100 (ETT58_06095) | - | 1176228..1178585 (-) | 2358 | WP_010922453.1 | hypothetical protein | - |
| ETT58_RS06105 (ETT58_06100) | - | 1178585..1178956 (-) | 372 | WP_010922454.1 | DUF5361 domain-containing protein | - |
| ETT58_RS06110 (ETT58_06105) | - | 1178971..1179234 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT58_RS06115 (ETT58_06110) | - | 1179245..1179838 (-) | 594 | WP_010922456.1 | tail protein | - |
| ETT58_RS06120 (ETT58_06115) | - | 1179850..1180185 (-) | 336 | WP_011285616.1 | hypothetical protein | - |
| ETT58_RS06125 (ETT58_06120) | - | 1180186..1180422 (-) | 237 | WP_010922457.1 | hypothetical protein | - |
| ETT58_RS06130 (ETT58_06125) | - | 1180415..1180753 (-) | 339 | WP_011285617.1 | hypothetical protein | - |
| ETT58_RS06135 (ETT58_06130) | - | 1180713..1181135 (-) | 423 | WP_010922459.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT58_RS06140 (ETT58_06135) | - | 1181145..1181345 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT58_RS06145 (ETT58_06140) | - | 1181345..1182256 (-) | 912 | WP_010922461.1 | phage major capsid protein | - |
| ETT58_RS06150 (ETT58_06145) | - | 1182281..1182742 (-) | 462 | WP_011285618.1 | DUF4355 domain-containing protein | - |
| ETT58_RS06155 (ETT58_06150) | - | 1182823..1184238 (-) | 1416 | WP_011285619.1 | terminase | - |
| ETT58_RS06160 (ETT58_06155) | - | 1184348..1184614 (-) | 267 | WP_010922464.1 | hypothetical protein | - |
| ETT58_RS06165 (ETT58_06160) | - | 1184607..1184786 (-) | 180 | WP_015055972.1 | hypothetical protein | - |
| ETT58_RS06170 (ETT58_06165) | - | 1184836..1185060 (-) | 225 | WP_010922466.1 | hypothetical protein | - |
| ETT58_RS06175 (ETT58_06170) | - | 1185066..1186559 (-) | 1494 | WP_015446231.1 | hypothetical protein | - |
| ETT58_RS06180 (ETT58_06175) | - | 1186552..1187820 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| ETT58_RS06185 (ETT58_06180) | - | 1187817..1188173 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT58_RS06190 (ETT58_06185) | - | 1188322..1188666 (-) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ETT58_RS06195 (ETT58_06190) | - | 1188775..1189194 (-) | 420 | WP_010922470.1 | DUF1492 domain-containing protein | - |
| ETT58_RS06200 (ETT58_06195) | - | 1189462..1190097 (-) | 636 | WP_010922070.1 | N-6 DNA methylase | - |
| ETT58_RS06205 (ETT58_06200) | - | 1190099..1190368 (-) | 270 | WP_002988369.1 | hypothetical protein | - |
| ETT58_RS06210 (ETT58_06205) | - | 1190452..1190964 (-) | 513 | WP_002988366.1 | hypothetical protein | - |
| ETT58_RS06215 (ETT58_06210) | - | 1190961..1191302 (-) | 342 | WP_002988364.1 | hypothetical protein | - |
| ETT58_RS09540 | - | 1191480..1191647 (-) | 168 | WP_011285624.1 | hypothetical protein | - |
| ETT58_RS06220 (ETT58_06215) | - | 1191657..1192454 (-) | 798 | WP_011285625.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ETT58_RS06225 (ETT58_06220) | - | 1192451..1193380 (-) | 930 | WP_011285626.1 | recombinase RecT | - |
| ETT58_RS06230 (ETT58_06225) | - | 1193383..1193712 (-) | 330 | WP_002988359.1 | hypothetical protein | - |
| ETT58_RS06235 (ETT58_06230) | - | 1193768..1193974 (-) | 207 | WP_011017565.1 | hypothetical protein | - |
| ETT58_RS06240 (ETT58_06235) | - | 1193983..1194123 (-) | 141 | WP_011017992.1 | hypothetical protein | - |
| ETT58_RS06245 (ETT58_06240) | - | 1194120..1194353 (-) | 234 | WP_002985387.1 | hypothetical protein | - |
| ETT58_RS06250 (ETT58_06245) | - | 1194334..1194723 (-) | 390 | WP_011285627.1 | DnaD domain-containing protein | - |
| ETT58_RS09700 (ETT58_06250) | - | 1194868..1195107 (-) | 240 | WP_002985390.1 | hypothetical protein | - |
| ETT58_RS06260 (ETT58_06255) | - | 1195207..1195392 (-) | 186 | WP_011285628.1 | hypothetical protein | - |
| ETT58_RS06265 (ETT58_06260) | - | 1195394..1195705 (-) | 312 | WP_002990080.1 | hypothetical protein | - |
| ETT58_RS06270 (ETT58_06265) | - | 1195783..1195968 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ETT58_RS06275 (ETT58_06270) | - | 1196135..1196374 (+) | 240 | WP_011284879.1 | hypothetical protein | - |
| ETT58_RS06280 (ETT58_06275) | - | 1196516..1197322 (+) | 807 | WP_011285629.1 | TIGR02391 family protein | - |
| ETT58_RS06285 (ETT58_06280) | - | 1197257..1197523 (-) | 267 | WP_010922204.1 | hypothetical protein | - |
| ETT58_RS06290 (ETT58_06285) | - | 1197555..1198271 (-) | 717 | WP_011285630.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT58_RS06295 (ETT58_06290) | - | 1198283..1198474 (-) | 192 | WP_002993390.1 | hypothetical protein | - |
| ETT58_RS06300 (ETT58_06295) | - | 1199110..1199205 (+) | 96 | WP_020837421.1 | type I toxin-antitoxin system Fst family toxin | - |
| ETT58_RS06305 (ETT58_06300) | - | 1199628..1199975 (+) | 348 | WP_011285631.1 | helix-turn-helix domain-containing protein | - |
| ETT58_RS06310 (ETT58_06305) | - | 1199979..1200359 (+) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT58_RS06315 (ETT58_06310) | - | 1200371..1200637 (+) | 267 | WP_011285632.1 | DUF4177 domain-containing protein | - |
| ETT58_RS06320 (ETT58_06315) | - | 1200761..1201903 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT58_RS06325 (ETT58_06320) | - | 1201993..1202268 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT58_RS06330 (ETT58_06325) | - | 1202367..1202954 (-) | 588 | WP_010922482.1 | YpmS family protein | - |
| ETT58_RS06335 (ETT58_06330) | - | 1202932..1203774 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6841.79 Da Isoelectric Point: 4.5183
>NTDB_id=341755 ETT58_RS06050 WP_011017964.1 1168782..1168964(-) (prx) [Streptococcus pyogenes strain emm1]
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYDEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=341755 ETT58_RS06050 WP_011017964.1 1168782..1168964(-) (prx) [Streptococcus pyogenes strain emm1]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
68.333 |
0.617 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |