Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT59_RS05190 | Genome accession | NZ_CP035440 |
| Coordinates | 1026207..1026395 (-) | Length | 62 a.a. |
| NCBI ID | WP_136105726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm124 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1026207..1043770 | 1026207..1026395 | within | 0 |
Gene organization within MGE regions
Location: 1026207..1043770
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT59_RS05190 (ETT59_05190) | prx | 1026207..1026395 (-) | 189 | WP_136105726.1 | Paratox | Regulator |
| ETT59_RS05195 (ETT59_05195) | - | 1027099..1027317 (-) | 219 | Protein_935 | SH3 domain-containing protein | - |
| ETT59_RS05200 (ETT59_05200) | - | 1027406..1027645 (-) | 240 | WP_014411882.1 | helix-turn-helix transcriptional regulator | - |
| ETT59_RS05205 (ETT59_05205) | - | 1027742..1028521 (+) | 780 | WP_085613681.1 | hypothetical protein | - |
| ETT59_RS05210 (ETT59_05210) | - | 1028655..1028813 (-) | 159 | WP_085613682.1 | hypothetical protein | - |
| ETT59_RS05215 (ETT59_05215) | - | 1029186..1029974 (+) | 789 | WP_111676459.1 | S24 family peptidase | - |
| ETT59_RS05220 (ETT59_05220) | - | 1029984..1030289 (+) | 306 | WP_011106738.1 | membrane protein | - |
| ETT59_RS05225 (ETT59_05225) | - | 1030413..1031552 (+) | 1140 | WP_002990094.1 | site-specific integrase | - |
| ETT59_RS05230 (ETT59_05230) | rfbB | 1031646..1032686 (-) | 1041 | WP_010922196.1 | dTDP-glucose 4,6-dehydratase | - |
| ETT59_RS05235 (ETT59_05235) | - | 1032930..1033523 (-) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ETT59_RS05240 (ETT59_05240) | rfbA | 1033523..1034392 (-) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| ETT59_RS05245 (ETT59_05245) | - | 1034450..1035559 (-) | 1110 | WP_136305947.1 | FAD-binding oxidoreductase | - |
| ETT59_RS05250 (ETT59_05250) | - | 1035599..1036387 (-) | 789 | WP_002984887.1 | Nif3-like dinuclear metal center hexameric protein | - |
| ETT59_RS05255 (ETT59_05255) | - | 1036377..1037063 (-) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| ETT59_RS05260 (ETT59_05260) | nth | 1037135..1037791 (-) | 657 | WP_010922193.1 | endonuclease III | - |
| ETT59_RS05265 (ETT59_05265) | - | 1037788..1038471 (-) | 684 | WP_053308318.1 | DnaD domain-containing protein | - |
| ETT59_RS05270 (ETT59_05270) | - | 1038552..1039070 (-) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| ETT59_RS05275 (ETT59_05275) | recJ | 1039220..1041430 (-) | 2211 | WP_136047837.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ETT59_RS05280 (ETT59_05280) | - | 1041427..1042191 (-) | 765 | WP_002984893.1 | SDR family oxidoreductase | - |
| ETT59_RS05285 (ETT59_05285) | rnz | 1042191..1043120 (-) | 930 | WP_136305946.1 | ribonuclease Z | - |
| ETT59_RS05290 (ETT59_05290) | - | 1043135..1043770 (-) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7238.14 Da Isoelectric Point: 3.9282
>NTDB_id=341703 ETT59_RS05190 WP_136105726.1 1026207..1026395(-) (prx) [Streptococcus pyogenes strain emm124]
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=341703 ETT59_RS05190 WP_136105726.1 1026207..1026395(-) (prx) [Streptococcus pyogenes strain emm124]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
93.548 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
70 |
96.774 |
0.677 |
| prx | Streptococcus pyogenes MGAS8232 |
71.186 |
95.161 |
0.677 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
67.742 |
0.5 |