Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT60_RS04285 | Genome accession | NZ_CP035439 |
| Coordinates | 803130..803318 (+) | Length | 62 a.a. |
| NCBI ID | WP_136022789.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm77 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 753110..803318 | 803130..803318 | within | 0 |
Gene organization within MGE regions
Location: 753110..803318
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT60_RS03930 (ETT60_03920) | recJ | 753110..755320 (+) | 2211 | WP_129284068.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ETT60_RS03935 (ETT60_03925) | - | 755470..755988 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| ETT60_RS03940 (ETT60_03930) | - | 756069..756752 (+) | 684 | WP_129284067.1 | DnaD domain-containing protein | - |
| ETT60_RS03945 (ETT60_03935) | nth | 756749..757405 (+) | 657 | WP_009880671.1 | endonuclease III | - |
| ETT60_RS03950 (ETT60_03940) | - | 757477..758163 (+) | 687 | WP_002984888.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| ETT60_RS03955 (ETT60_03945) | - | 758153..758941 (+) | 789 | WP_002984887.1 | Nif3-like dinuclear metal center hexameric protein | - |
| ETT60_RS03960 (ETT60_03950) | - | 758981..760090 (+) | 1110 | WP_136038604.1 | FAD-binding oxidoreductase | - |
| ETT60_RS03965 (ETT60_03955) | rfbA | 760148..761017 (+) | 870 | WP_014407521.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| ETT60_RS03970 (ETT60_03960) | - | 761017..761610 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ETT60_RS03975 (ETT60_03965) | rfbB | 761855..762895 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| ETT60_RS03980 (ETT60_03970) | - | 762978..764117 (-) | 1140 | WP_002990094.1 | site-specific integrase | - |
| ETT60_RS03985 (ETT60_03975) | - | 764254..764934 (-) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT60_RS03990 (ETT60_03980) | - | 764972..765727 (-) | 756 | WP_002990090.1 | XRE family transcriptional regulator | - |
| ETT60_RS09170 | - | 766084..766233 (+) | 150 | WP_168389386.1 | hypothetical protein | - |
| ETT60_RS04000 (ETT60_03990) | - | 766222..766434 (-) | 213 | WP_136022811.1 | hypothetical protein | - |
| ETT60_RS04005 (ETT60_03995) | - | 766493..766651 (+) | 159 | WP_111711563.1 | hypothetical protein | - |
| ETT60_RS04010 (ETT60_04000) | - | 766785..767564 (-) | 780 | WP_136022810.1 | hypothetical protein | - |
| ETT60_RS04015 (ETT60_04005) | - | 767661..767888 (+) | 228 | WP_002990088.1 | hypothetical protein | - |
| ETT60_RS04020 (ETT60_04010) | - | 767939..768661 (+) | 723 | WP_032460391.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT60_RS04025 (ETT60_04015) | - | 768759..768998 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| ETT60_RS04030 (ETT60_04020) | - | 769165..769350 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| ETT60_RS04035 (ETT60_04025) | - | 769429..769746 (+) | 318 | WP_063631315.1 | hypothetical protein | - |
| ETT60_RS04040 (ETT60_04030) | - | 769743..769880 (+) | 138 | WP_002984309.1 | hypothetical protein | - |
| ETT60_RS04045 (ETT60_04035) | - | 769961..770290 (+) | 330 | WP_011284878.1 | hypothetical protein | - |
| ETT60_RS04050 (ETT60_04040) | - | 770290..770484 (+) | 195 | WP_002984315.1 | hypothetical protein | - |
| ETT60_RS04055 (ETT60_04045) | - | 770481..770765 (+) | 285 | WP_011284877.1 | hypothetical protein | - |
| ETT60_RS04060 (ETT60_04050) | - | 770762..771445 (+) | 684 | WP_014635524.1 | AAA family ATPase | - |
| ETT60_RS04065 (ETT60_04055) | - | 771451..772881 (+) | 1431 | Protein_731 | DEAD/DEAH box helicase | - |
| ETT60_RS04070 (ETT60_04060) | - | 772886..773368 (+) | 483 | WP_085577342.1 | DUF669 domain-containing protein | - |
| ETT60_RS04075 (ETT60_04065) | - | 773386..774939 (+) | 1554 | WP_011017876.1 | hypothetical protein | - |
| ETT60_RS04080 (ETT60_04070) | - | 775206..776075 (+) | 870 | WP_014635521.1 | bifunctional DNA primase/polymerase | - |
| ETT60_RS04085 (ETT60_04075) | - | 776095..776379 (+) | 285 | WP_227874671.1 | VRR-NUC domain-containing protein | - |
| ETT60_RS04090 (ETT60_04080) | - | 776363..776719 (+) | 357 | WP_023078113.1 | hypothetical protein | - |
| ETT60_RS09445 (ETT60_04085) | - | 776716..776967 (+) | 252 | WP_136022808.1 | hypothetical protein | - |
| ETT60_RS04100 (ETT60_04090) | - | 776961..777245 (+) | 285 | WP_136112974.1 | DUF3310 domain-containing protein | - |
| ETT60_RS04105 (ETT60_04095) | - | 777242..777511 (+) | 270 | WP_023610894.1 | hypothetical protein | - |
| ETT60_RS04110 (ETT60_04100) | - | 777521..777781 (+) | 261 | WP_136114694.1 | hypothetical protein | - |
| ETT60_RS04115 (ETT60_04105) | - | 777794..778195 (+) | 402 | WP_063631320.1 | hypothetical protein | - |
| ETT60_RS04120 (ETT60_04110) | - | 778195..778830 (+) | 636 | WP_063631321.1 | N-6 DNA methylase | - |
| ETT60_RS04125 (ETT60_04115) | - | 779103..779543 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT60_RS04135 (ETT60_04125) | - | 780136..780630 (+) | 495 | WP_136022806.1 | terminase small subunit | - |
| ETT60_RS04140 (ETT60_04130) | - | 780608..781915 (+) | 1308 | WP_136022805.1 | PBSX family phage terminase large subunit | - |
| ETT60_RS04145 (ETT60_04135) | - | 781927..783426 (+) | 1500 | WP_136022804.1 | phage portal protein | - |
| ETT60_RS04150 (ETT60_04140) | - | 783401..784321 (+) | 921 | WP_136022803.1 | minor capsid protein | - |
| ETT60_RS04155 (ETT60_04145) | - | 784336..784515 (+) | 180 | WP_050316441.1 | hypothetical protein | - |
| ETT60_RS04160 (ETT60_04150) | - | 784508..784777 (+) | 270 | WP_136022802.1 | hypothetical protein | - |
| ETT60_RS09385 | - | 784779..784913 (+) | 135 | WP_015055956.1 | hypothetical protein | - |
| ETT60_RS04165 (ETT60_04155) | - | 785007..785540 (+) | 534 | WP_046177710.1 | DUF4355 domain-containing protein | - |
| ETT60_RS04170 (ETT60_04160) | - | 785550..785951 (+) | 402 | WP_136022801.1 | head decoration protein | - |
| ETT60_RS04175 (ETT60_04165) | - | 785951..787036 (+) | 1086 | WP_136022800.1 | major capsid protein | - |
| ETT60_RS04180 (ETT60_04170) | - | 787046..787288 (+) | 243 | WP_063812977.1 | HeH/LEM domain-containing protein | - |
| ETT60_RS04185 (ETT60_04175) | - | 787302..787655 (+) | 354 | WP_063812978.1 | phage head-tail connector protein | - |
| ETT60_RS04190 (ETT60_04180) | - | 787652..787948 (+) | 297 | WP_136022799.1 | hypothetical protein | - |
| ETT60_RS04195 (ETT60_04185) | - | 787948..788304 (+) | 357 | WP_136022798.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT60_RS04200 (ETT60_04190) | - | 788301..788687 (+) | 387 | WP_063812981.1 | hypothetical protein | - |
| ETT60_RS04205 (ETT60_04195) | - | 788688..789248 (+) | 561 | WP_136022797.1 | phage major tail protein, TP901-1 family | - |
| ETT60_RS04210 (ETT60_04200) | - | 789261..789629 (+) | 369 | WP_136022796.1 | tail assembly chaperone | - |
| ETT60_RS09320 | - | 789767..789958 (+) | 192 | WP_227875247.1 | hypothetical protein | - |
| ETT60_RS04220 (ETT60_04210) | - | 789968..792967 (+) | 3000 | WP_136022795.1 | phage tail tape measure protein | - |
| ETT60_RS04225 (ETT60_04215) | - | 792967..793737 (+) | 771 | WP_136022794.1 | distal tail protein Dit | - |
| ETT60_RS04230 (ETT60_04220) | - | 793734..795845 (+) | 2112 | WP_136022793.1 | phage tail spike protein | - |
| ETT60_RS04235 (ETT60_04225) | - | 795842..797056 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| ETT60_RS04240 (ETT60_04230) | - | 797058..797372 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| ETT60_RS04245 (ETT60_04235) | - | 797383..799278 (+) | 1896 | WP_136114693.1 | gp58-like family protein | - |
| ETT60_RS04250 (ETT60_04240) | - | 799292..799453 (+) | 162 | WP_002988795.1 | hypothetical protein | - |
| ETT60_RS04255 (ETT60_04245) | - | 799456..800067 (+) | 612 | WP_136022792.1 | hypothetical protein | - |
| ETT60_RS04260 (ETT60_04250) | - | 800077..800373 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| ETT60_RS04265 (ETT60_04255) | - | 800370..800555 (+) | 186 | WP_002990010.1 | holin | - |
| ETT60_RS04270 (ETT60_04260) | - | 800667..802001 (+) | 1335 | WP_011284838.1 | GH25 family lysozyme | - |
| ETT60_RS04275 (ETT60_04265) | - | 802250..802525 (+) | 276 | WP_136022791.1 | hypothetical protein | - |
| ETT60_RS04280 (ETT60_04270) | - | 802527..803012 (+) | 486 | WP_136022790.1 | hypothetical protein | - |
| ETT60_RS04285 (ETT60_04275) | prx | 803130..803318 (+) | 189 | WP_136022789.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7268.17 Da Isoelectric Point: 3.9282
>NTDB_id=341647 ETT60_RS04285 WP_136022789.1 803130..803318(+) (prx) [Streptococcus pyogenes strain emm77]
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
MLTYDEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=341647 ETT60_RS04285 WP_136022789.1 803130..803318(+) (prx) [Streptococcus pyogenes strain emm77]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
93.548 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS8232 |
72.881 |
95.161 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
88.095 |
67.742 |
0.597 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |