Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT61_RS03505 | Genome accession | NZ_CP035438 |
| Coordinates | 620754..620936 (+) | Length | 60 a.a. |
| NCBI ID | WP_136020455.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm22.8 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 585502..620936 | 620754..620936 | within | 0 |
Gene organization within MGE regions
Location: 585502..620936
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT61_RS03245 (ETT61_03235) | - | 585502..586959 (-) | 1458 | WP_111676611.1 | recombinase family protein | - |
| ETT61_RS03250 (ETT61_03240) | - | 587089..587295 (-) | 207 | WP_227877800.1 | hypothetical protein | - |
| ETT61_RS03255 (ETT61_03245) | - | 587302..588021 (-) | 720 | WP_136020203.1 | XRE family transcriptional regulator | - |
| ETT61_RS03260 (ETT61_03250) | - | 588204..588410 (+) | 207 | WP_136020204.1 | helix-turn-helix transcriptional regulator | - |
| ETT61_RS03265 (ETT61_03255) | - | 588458..588679 (+) | 222 | WP_136020205.1 | antitoxin | - |
| ETT61_RS10115 | - | 588690..588848 (+) | 159 | WP_168389626.1 | hypothetical protein | - |
| ETT61_RS10120 | - | 588845..589138 (-) | 294 | WP_136114802.1 | hypothetical protein | - |
| ETT61_RS03270 (ETT61_03260) | - | 589215..589433 (+) | 219 | WP_168389627.1 | hypothetical protein | - |
| ETT61_RS10125 | - | 589430..589588 (-) | 159 | WP_153276795.1 | hypothetical protein | - |
| ETT61_RS03275 (ETT61_03265) | - | 589823..590008 (+) | 186 | WP_136020207.1 | hypothetical protein | - |
| ETT61_RS10315 (ETT61_03270) | - | 590102..590371 (+) | 270 | WP_038433488.1 | replication protein | - |
| ETT61_RS03285 (ETT61_03275) | - | 590527..590916 (+) | 390 | WP_136020208.1 | DnaD domain-containing protein | - |
| ETT61_RS03290 (ETT61_03280) | - | 590897..591130 (+) | 234 | WP_002988350.1 | hypothetical protein | - |
| ETT61_RS03295 (ETT61_03285) | - | 591127..591267 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| ETT61_RS03300 (ETT61_03290) | - | 591276..591482 (+) | 207 | WP_011017565.1 | hypothetical protein | - |
| ETT61_RS03305 (ETT61_03295) | - | 591538..591867 (+) | 330 | WP_063629030.1 | hypothetical protein | - |
| ETT61_RS03310 (ETT61_03300) | - | 591870..592841 (+) | 972 | WP_136020209.1 | recombinase RecT | - |
| ETT61_RS03315 (ETT61_03305) | - | 592838..593038 (+) | 201 | WP_000594115.1 | hypothetical protein | - |
| ETT61_RS03320 (ETT61_03310) | - | 593031..593828 (+) | 798 | WP_002988362.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| ETT61_RS03325 (ETT61_03315) | - | 594006..594347 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT61_RS03330 (ETT61_03320) | - | 594344..594856 (+) | 513 | WP_032463367.1 | phage protein | - |
| ETT61_RS10320 (ETT61_03325) | - | 594843..595028 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| ETT61_RS03340 (ETT61_03330) | - | 595033..595302 (+) | 270 | WP_111684751.1 | hypothetical protein | - |
| ETT61_RS03345 (ETT61_03335) | - | 595305..596054 (+) | 750 | WP_136020210.1 | site-specific DNA-methyltransferase | - |
| ETT61_RS03350 (ETT61_03340) | - | 596563..596982 (+) | 420 | WP_021733384.1 | DUF1492 domain-containing protein | - |
| ETT61_RS03355 (ETT61_03345) | - | 597093..597437 (+) | 345 | WP_010922469.1 | HNH endonuclease signature motif containing protein | - |
| ETT61_RS03360 (ETT61_03350) | - | 597586..597942 (+) | 357 | WP_002994106.1 | hypothetical protein | - |
| ETT61_RS03365 (ETT61_03355) | - | 597939..599207 (+) | 1269 | WP_136020527.1 | phage portal protein | - |
| ETT61_RS03370 (ETT61_03360) | - | 599200..600693 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| ETT61_RS03375 (ETT61_03365) | - | 600699..600923 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT61_RS10130 | - | 601000..601152 (+) | 153 | WP_011054687.1 | hypothetical protein | - |
| ETT61_RS03380 (ETT61_03370) | - | 601145..601411 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT61_RS03385 (ETT61_03375) | - | 601413..601649 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| ETT61_RS03390 (ETT61_03380) | - | 601731..603146 (+) | 1416 | WP_136020531.1 | terminase | - |
| ETT61_RS03395 (ETT61_03385) | - | 603228..603689 (+) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| ETT61_RS03400 (ETT61_03390) | - | 603714..604625 (+) | 912 | WP_011528788.1 | phage major capsid protein | - |
| ETT61_RS03405 (ETT61_03395) | - | 604625..604825 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT61_RS03410 (ETT61_03400) | - | 604835..605257 (+) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT61_RS03415 (ETT61_03405) | - | 605217..605555 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| ETT61_RS03420 (ETT61_03410) | - | 605548..605784 (+) | 237 | WP_000032787.1 | hypothetical protein | - |
| ETT61_RS03425 (ETT61_03415) | - | 605785..606120 (+) | 336 | WP_011528787.1 | hypothetical protein | - |
| ETT61_RS03430 (ETT61_03420) | - | 606132..606710 (+) | 579 | WP_011888768.1 | hypothetical protein | - |
| ETT61_RS03435 (ETT61_03425) | - | 606721..606984 (+) | 264 | WP_010922455.1 | hypothetical protein | - |
| ETT61_RS03440 (ETT61_03430) | - | 606999..607370 (+) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| ETT61_RS03445 (ETT61_03435) | - | 607370..609727 (+) | 2358 | WP_136020450.1 | hypothetical protein | - |
| ETT61_RS03450 (ETT61_03440) | - | 609724..610419 (+) | 696 | WP_010922452.1 | hypothetical protein | - |
| ETT61_RS03455 (ETT61_03445) | - | 610416..612368 (+) | 1953 | WP_136020451.1 | phage tail spike protein | - |
| ETT61_RS03460 (ETT61_03450) | - | 612368..613483 (+) | 1116 | WP_136020452.1 | hyaluronoglucosaminidase | - |
| ETT61_RS03465 (ETT61_03455) | - | 613493..615433 (+) | 1941 | WP_111676577.1 | gp58-like family protein | - |
| ETT61_RS03470 (ETT61_03460) | - | 615442..615870 (+) | 429 | WP_111676575.1 | DUF1617 family protein | - |
| ETT61_RS03475 (ETT61_03465) | - | 615873..616505 (+) | 633 | WP_136020453.1 | hypothetical protein | - |
| ETT61_RS03480 (ETT61_03470) | - | 616517..616789 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT61_RS03485 (ETT61_03475) | - | 616786..617013 (+) | 228 | WP_003058873.1 | phage holin | - |
| ETT61_RS03490 (ETT61_03480) | - | 617132..618349 (+) | 1218 | WP_136020454.1 | peptidoglycan amidohydrolase family protein | - |
| ETT61_RS03495 (ETT61_03485) | - | 618487..619611 (+) | 1125 | WP_023609814.1 | Fic family protein | - |
| ETT61_RS03500 (ETT61_03490) | entC3 | 619859..620641 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| ETT61_RS03505 (ETT61_03495) | prx | 620754..620936 (+) | 183 | WP_136020455.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6930.90 Da Isoelectric Point: 4.4797
>NTDB_id=341590 ETT61_RS03505 WP_136020455.1 620754..620936(+) (prx) [Streptococcus pyogenes strain emm22.8]
MLTYNEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYNEFKQAIDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=341590 ETT61_RS03505 WP_136020455.1 620754..620936(+) (prx) [Streptococcus pyogenes strain emm22.8]
ATGCTAACATACAACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCAATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTAGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS8232 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
68.333 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
70 |
0.517 |