Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT64_RS03590 | Genome accession | NZ_CP035435 |
| Coordinates | 667247..667429 (+) | Length | 60 a.a. |
| NCBI ID | WP_136289652.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm64.3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 622189..667429 | 667247..667429 | within | 0 |
Gene organization within MGE regions
Location: 622189..667429
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT64_RS03250 (ETT64_03250) | - | 622189..622464 (+) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT64_RS03255 (ETT64_03255) | - | 622553..623695 (-) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT64_RS03260 (ETT64_03260) | - | 623820..624125 (-) | 306 | WP_011106738.1 | membrane protein | - |
| ETT64_RS03265 (ETT64_03265) | - | 624135..624923 (-) | 789 | WP_030127591.1 | S24 family peptidase | - |
| ETT64_RS09170 | - | 625294..625443 (+) | 150 | WP_021340643.1 | hypothetical protein | - |
| ETT64_RS03270 (ETT64_03270) | - | 625429..625644 (-) | 216 | WP_014635530.1 | hypothetical protein | - |
| ETT64_RS03275 (ETT64_03275) | - | 625703..625861 (+) | 159 | WP_021340638.1 | hypothetical protein | - |
| ETT64_RS03280 (ETT64_03280) | - | 625960..626601 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| ETT64_RS03285 (ETT64_03285) | - | 626694..626933 (+) | 240 | WP_014411882.1 | helix-turn-helix transcriptional regulator | - |
| ETT64_RS03290 (ETT64_03290) | - | 626944..627705 (+) | 762 | WP_023610918.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT64_RS09270 | - | 627718..627849 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| ETT64_RS03295 (ETT64_03295) | - | 627846..628028 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| ETT64_RS03300 (ETT64_03300) | - | 628134..628445 (+) | 312 | WP_032465116.1 | hypothetical protein | - |
| ETT64_RS09275 | - | 628447..628581 (+) | 135 | WP_261729371.1 | hypothetical protein | - |
| ETT64_RS03305 (ETT64_03305) | - | 628703..629464 (+) | 762 | WP_014635613.1 | DnaD domain protein | - |
| ETT64_RS03310 (ETT64_03310) | - | 629451..630233 (+) | 783 | WP_032465115.1 | ATP-binding protein | - |
| ETT64_RS09175 | - | 630224..630361 (+) | 138 | WP_011018145.1 | hypothetical protein | - |
| ETT64_RS03315 (ETT64_03315) | - | 630372..630728 (+) | 357 | WP_021341157.1 | HTH domain-containing protein | - |
| ETT64_RS03320 (ETT64_03320) | - | 630709..630963 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| ETT64_RS03325 (ETT64_03325) | - | 630985..631467 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| ETT64_RS03330 (ETT64_03330) | - | 631468..632142 (+) | 675 | WP_032465114.1 | ERF family protein | - |
| ETT64_RS03335 (ETT64_03335) | ssb | 632135..632560 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT64_RS03340 (ETT64_03340) | - | 632566..632769 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| ETT64_RS03345 (ETT64_03345) | - | 632769..633209 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT64_RS03350 (ETT64_03350) | - | 633206..633562 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| ETT64_RS09390 (ETT64_03355) | - | 633559..633810 (+) | 252 | WP_136074815.1 | hypothetical protein | - |
| ETT64_RS03360 (ETT64_03360) | - | 633804..634088 (+) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| ETT64_RS03365 (ETT64_03365) | - | 634085..634354 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| ETT64_RS03370 (ETT64_03370) | - | 634364..634777 (+) | 414 | WP_032460569.1 | YopX family protein | - |
| ETT64_RS03375 (ETT64_03375) | - | 634774..635058 (+) | 285 | WP_011017570.1 | hypothetical protein | - |
| ETT64_RS03380 (ETT64_03380) | - | 635062..635544 (+) | 483 | WP_011017571.1 | class I SAM-dependent methyltransferase | - |
| ETT64_RS03385 (ETT64_03385) | - | 635534..636298 (+) | 765 | WP_021299463.1 | site-specific DNA-methyltransferase | - |
| ETT64_RS03390 (ETT64_03390) | - | 636346..637077 (+) | 732 | WP_136281715.1 | DUF1642 domain-containing protein | - |
| ETT64_RS09180 | - | 637074..637244 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| ETT64_RS03395 (ETT64_03395) | - | 637517..637951 (+) | 435 | WP_032461637.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ETT64_RS03420 (ETT64_03420) | - | 638884..639798 (+) | 915 | WP_011284864.1 | hypothetical protein | - |
| ETT64_RS09185 | - | 639888..640121 (-) | 234 | WP_002995461.1 | hypothetical protein | - |
| ETT64_RS03430 (ETT64_03430) | - | 640416..640793 (-) | 378 | WP_002987543.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ETT64_RS03435 (ETT64_03435) | - | 640845..641030 (-) | 186 | WP_001132273.1 | type II toxin-antitoxin system HicA family toxin | - |
| ETT64_RS03445 (ETT64_03445) | - | 641266..641607 (+) | 342 | WP_029714359.1 | HNH endonuclease | - |
| ETT64_RS03450 (ETT64_03450) | - | 641775..642242 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| ETT64_RS03455 (ETT64_03455) | - | 642245..642475 (+) | 231 | WP_002985368.1 | hypothetical protein | - |
| ETT64_RS03460 (ETT64_03460) | - | 642479..644233 (+) | 1755 | WP_024623442.1 | terminase large subunit | - |
| ETT64_RS09190 | - | 644230..644400 (+) | 171 | WP_002985365.1 | hypothetical protein | - |
| ETT64_RS03465 (ETT64_03465) | - | 644393..644617 (+) | 225 | WP_002985363.1 | hypothetical protein | - |
| ETT64_RS03470 (ETT64_03470) | - | 644651..645871 (+) | 1221 | WP_063631323.1 | phage portal protein | - |
| ETT64_RS03475 (ETT64_03475) | - | 645849..646514 (+) | 666 | WP_063631324.1 | head maturation protease, ClpP-related | - |
| ETT64_RS03480 (ETT64_03480) | - | 646540..647742 (+) | 1203 | WP_023610889.1 | phage major capsid protein | - |
| ETT64_RS09195 | - | 647729..647875 (+) | 147 | WP_023610896.1 | hypothetical protein | - |
| ETT64_RS03485 (ETT64_03485) | - | 647878..648180 (+) | 303 | WP_063631325.1 | head-tail connector protein | - |
| ETT64_RS03490 (ETT64_03490) | - | 648177..648524 (+) | 348 | WP_002985351.1 | phage head closure protein | - |
| ETT64_RS03495 (ETT64_03495) | - | 648521..648898 (+) | 378 | WP_002985349.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT64_RS03500 (ETT64_03500) | - | 648952..649320 (+) | 369 | WP_227874827.1 | hypothetical protein | - |
| ETT64_RS03505 (ETT64_03505) | - | 649337..649945 (+) | 609 | WP_014411858.1 | major tail protein | - |
| ETT64_RS03510 (ETT64_03510) | gpG | 649998..650324 (+) | 327 | WP_014411857.1 | phage tail assembly chaperone G | - |
| ETT64_RS09200 | - | 650354..650521 (+) | 168 | WP_014411856.1 | hypothetical protein | - |
| ETT64_RS03515 (ETT64_03515) | - | 650534..654457 (+) | 3924 | WP_002985338.1 | phage tail tape measure protein | - |
| ETT64_RS03520 (ETT64_03520) | - | 654457..655164 (+) | 708 | WP_011527559.1 | distal tail protein Dit | - |
| ETT64_RS03525 (ETT64_03525) | - | 655161..657305 (+) | 2145 | WP_136283779.1 | phage tail spike protein | - |
| ETT64_RS03530 (ETT64_03530) | - | 657302..658423 (+) | 1122 | WP_136075485.1 | hyaluronoglucosaminidase | - |
| ETT64_RS03535 (ETT64_03535) | - | 658433..660337 (+) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| ETT64_RS03540 (ETT64_03540) | - | 660349..660777 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| ETT64_RS03545 (ETT64_03545) | - | 660780..661418 (+) | 639 | WP_046735270.1 | hypothetical protein | - |
| ETT64_RS03550 (ETT64_03550) | - | 661430..661702 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| ETT64_RS03555 (ETT64_03555) | - | 661699..661926 (+) | 228 | WP_003058873.1 | phage holin | - |
| ETT64_RS03560 (ETT64_03560) | - | 662042..663244 (+) | 1203 | WP_020837640.1 | glucosaminidase domain-containing protein | - |
| ETT64_RS03565 (ETT64_03565) | - | 663384..663908 (+) | 525 | WP_011017840.1 | Panacea domain-containing protein | - |
| ETT64_RS03570 (ETT64_03570) | - | 663896..664762 (+) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| ETT64_RS03575 (ETT64_03575) | spek | 665066..665845 (+) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| ETT64_RS03580 (ETT64_03580) | - | 666321..666899 (+) | 579 | WP_136293084.1 | phospholipase | - |
| ETT64_RS03590 (ETT64_03590) | prx | 667247..667429 (+) | 183 | WP_136289652.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6918.85 Da Isoelectric Point: 4.2404
>NTDB_id=341433 ETT64_RS03590 WP_136289652.1 667247..667429(+) (prx) [Streptococcus pyogenes strain emm64.3]
MLTYDEFKQAIDDGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MLTYDEFKQAIDDGYITGDTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=341433 ETT64_RS03590 WP_136289652.1 667247..667429(+) (prx) [Streptococcus pyogenes strain emm64.3]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTTTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS8232 |
91.667 |
100 |
0.917 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
71.667 |
0.65 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |