Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT69_RS03405 | Genome accession | NZ_CP035430 |
| Coordinates | 619723..619902 (+) | Length | 59 a.a. |
| NCBI ID | WP_136019510.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm55 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 576794..619902 | 619723..619902 | within | 0 |
Gene organization within MGE regions
Location: 576794..619902
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT69_RS03110 (ETT69_03100) | - | 576794..577735 (-) | 942 | WP_076639338.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| ETT69_RS03115 (ETT69_03105) | - | 578129..578578 (+) | 450 | WP_032460256.1 | flavodoxin | - |
| ETT69_RS03120 (ETT69_03110) | - | 578754..579038 (+) | 285 | WP_136019533.1 | chorismate mutase | - |
| ETT69_RS03125 (ETT69_03115) | - | 579031..580293 (+) | 1263 | WP_076639337.1 | voltage-gated chloride channel family protein | - |
| ETT69_RS03130 (ETT69_03120) | rplS | 580408..580755 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| ETT69_RS03140 (ETT69_03130) | - | 581118..582194 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| ETT69_RS03145 (ETT69_03135) | - | 582313..582834 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| ETT69_RS03150 (ETT69_03140) | - | 582845..583222 (-) | 378 | WP_030126053.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT69_RS03155 (ETT69_03145) | - | 583206..583565 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| ETT69_RS03160 (ETT69_03150) | - | 583753..583971 (+) | 219 | WP_023612341.1 | helix-turn-helix domain-containing protein | - |
| ETT69_RS03165 (ETT69_03155) | - | 584069..584299 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| ETT69_RS03170 (ETT69_03160) | - | 584436..584654 (+) | 219 | WP_003056177.1 | hypothetical protein | - |
| ETT69_RS03175 (ETT69_03165) | - | 584656..584898 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| ETT69_RS03180 (ETT69_03170) | - | 584885..586201 (+) | 1317 | WP_247275458.1 | AAA family ATPase | - |
| ETT69_RS03185 (ETT69_03175) | - | 586216..587298 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| ETT69_RS03190 (ETT69_03180) | - | 587337..587759 (+) | 423 | WP_111679387.1 | hypothetical protein | - |
| ETT69_RS03195 (ETT69_03185) | - | 587761..588495 (+) | 735 | WP_136019531.1 | hypothetical protein | - |
| ETT69_RS03200 (ETT69_03190) | - | 588517..589110 (+) | 594 | WP_136019530.1 | hypothetical protein | - |
| ETT69_RS03205 (ETT69_03195) | - | 589110..590693 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| ETT69_RS03210 (ETT69_03200) | - | 590706..590900 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| ETT69_RS03215 (ETT69_03205) | - | 590923..593166 (+) | 2244 | WP_136019529.1 | AAA family ATPase | - |
| ETT69_RS03220 (ETT69_03210) | - | 593458..593640 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| ETT69_RS03225 (ETT69_03215) | - | 593633..594028 (+) | 396 | WP_003059076.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ETT69_RS03230 (ETT69_03220) | - | 594025..594249 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| ETT69_RS03235 (ETT69_03225) | - | 594252..594437 (+) | 186 | WP_136019528.1 | hypothetical protein | - |
| ETT69_RS03240 (ETT69_03230) | - | 594434..594718 (+) | 285 | WP_247275459.1 | DUF3310 domain-containing protein | - |
| ETT69_RS03245 (ETT69_03235) | - | 594715..594984 (+) | 270 | WP_136019527.1 | hypothetical protein | - |
| ETT69_RS03250 (ETT69_03240) | - | 594994..595278 (+) | 285 | WP_136019526.1 | hypothetical protein | - |
| ETT69_RS03255 (ETT69_03245) | - | 595282..595464 (+) | 183 | WP_136019525.1 | hypothetical protein | - |
| ETT69_RS09720 | - | 595454..595612 (+) | 159 | WP_166525022.1 | hypothetical protein | - |
| ETT69_RS03260 (ETT69_03250) | - | 595631..596104 (+) | 474 | WP_136019524.1 | DUF1642 domain-containing protein | - |
| ETT69_RS03265 (ETT69_03255) | - | 596101..596514 (+) | 414 | WP_115256804.1 | transcriptional regulator | - |
| ETT69_RS03270 (ETT69_03260) | terS | 596640..597335 (+) | 696 | WP_115283419.1 | phage terminase small subunit | - |
| ETT69_RS03275 (ETT69_03265) | - | 597338..598624 (+) | 1287 | WP_231872416.1 | PBSX family phage terminase large subunit | - |
| ETT69_RS03280 (ETT69_03270) | - | 598638..600140 (+) | 1503 | WP_136019523.1 | phage portal protein | - |
| ETT69_RS03285 (ETT69_03275) | - | 600145..601623 (+) | 1479 | WP_030127691.1 | phage minor capsid protein | - |
| ETT69_RS03290 (ETT69_03280) | - | 601595..601834 (+) | 240 | WP_030127692.1 | hypothetical protein | - |
| ETT69_RS03295 (ETT69_03285) | - | 601894..602163 (+) | 270 | WP_136019522.1 | hypothetical protein | - |
| ETT69_RS03300 (ETT69_03290) | - | 602374..602988 (+) | 615 | WP_030127694.1 | hypothetical protein | - |
| ETT69_RS03305 (ETT69_03295) | - | 602992..603810 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| ETT69_RS03310 (ETT69_03300) | - | 603864..604280 (+) | 417 | WP_030127695.1 | hypothetical protein | - |
| ETT69_RS03315 (ETT69_03305) | - | 604270..604602 (+) | 333 | WP_030127753.1 | minor capsid protein | - |
| ETT69_RS03320 (ETT69_03310) | - | 604602..604958 (+) | 357 | WP_065361215.1 | minor capsid protein | - |
| ETT69_RS03325 (ETT69_03315) | - | 604955..605353 (+) | 399 | WP_030127726.1 | minor capsid protein | - |
| ETT69_RS03330 (ETT69_03320) | - | 605353..605838 (+) | 486 | WP_030127725.1 | phage tail tube protein | - |
| ETT69_RS03335 (ETT69_03325) | - | 605884..606318 (+) | 435 | WP_030127689.1 | hypothetical protein | - |
| ETT69_RS03340 (ETT69_03330) | - | 606327..606908 (+) | 582 | WP_065361216.1 | bacteriophage Gp15 family protein | - |
| ETT69_RS03345 (ETT69_03335) | - | 606898..610158 (+) | 3261 | WP_136019521.1 | tape measure protein | - |
| ETT69_RS03350 (ETT69_03340) | - | 610155..610871 (+) | 717 | WP_136019520.1 | distal tail protein Dit | - |
| ETT69_RS03355 (ETT69_03345) | - | 610868..613012 (+) | 2145 | WP_136019519.1 | phage tail spike protein | - |
| ETT69_RS03360 (ETT69_03350) | - | 613009..614013 (+) | 1005 | WP_136019518.1 | hyaluronoglucosaminidase | - |
| ETT69_RS03365 (ETT69_03355) | - | 614026..616041 (+) | 2016 | WP_136019517.1 | gp58-like family protein | - |
| ETT69_RS03370 (ETT69_03360) | - | 616050..616211 (+) | 162 | WP_012560658.1 | hypothetical protein | - |
| ETT69_RS03375 (ETT69_03365) | - | 616214..616822 (+) | 609 | WP_136019516.1 | DUF1366 domain-containing protein | - |
| ETT69_RS03380 (ETT69_03370) | - | 616834..617109 (+) | 276 | WP_136019515.1 | hypothetical protein | - |
| ETT69_RS03385 (ETT69_03375) | - | 617106..617333 (+) | 228 | WP_136019514.1 | phage holin | - |
| ETT69_RS03390 (ETT69_03380) | - | 617449..618645 (+) | 1197 | WP_136019513.1 | glucosaminidase domain-containing protein | - |
| ETT69_RS03395 (ETT69_03385) | - | 618903..619364 (+) | 462 | WP_168389137.1 | Panacea domain-containing protein | - |
| ETT69_RS03400 (ETT69_03390) | - | 619348..619662 (+) | 315 | WP_136019511.1 | hypothetical protein | - |
| ETT69_RS03405 (ETT69_03395) | prx | 619723..619902 (+) | 180 | WP_136019510.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6919.92 Da Isoelectric Point: 3.9944
>NTDB_id=341168 ETT69_RS03405 WP_136019510.1 619723..619902(+) (prx) [Streptococcus pyogenes strain emm55]
MLTYDEFKQAIDDGYIVGDTVKIVRKNGQIFDYVLPGEPVRLWEVATEEKVEEVLMELW
MLTYDEFKQAIDDGYIVGDTVKIVRKNGQIFDYVLPGEPVRLWEVATEEKVEEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=341168 ETT69_RS03405 WP_136019510.1 619723..619902(+) (prx) [Streptococcus pyogenes strain emm55]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGCGATACAGTTAAGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGCGATACAGTTAAGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGTGTTACCTGGTGAGCCTGTAAGATTGTGGGAAGTTGCGACAGAGGAAAAAGTGGAAGAAG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS8232 |
79.31 |
98.305 |
0.78 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
72.414 |
98.305 |
0.712 |
| prx | Streptococcus pyogenes MGAS315 |
92.683 |
69.492 |
0.644 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
78.049 |
69.492 |
0.542 |