Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT70_RS04140 | Genome accession | NZ_CP035429 |
| Coordinates | 773263..773451 (+) | Length | 62 a.a. |
| NCBI ID | WP_136105726.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emmNA | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 737698..773451 | 773263..773451 | within | 0 |
Gene organization within MGE regions
Location: 737698..773451
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT70_RS03870 (ETT70_03860) | - | 737698..738291 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ETT70_RS03875 (ETT70_03865) | rfbB | 738535..739575 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| ETT70_RS03880 (ETT70_03870) | - | 739658..740797 (-) | 1140 | WP_136275813.1 | site-specific integrase | - |
| ETT70_RS03885 (ETT70_03875) | - | 740925..741191 (-) | 267 | WP_002994745.1 | DUF4177 domain-containing protein | - |
| ETT70_RS03890 (ETT70_03880) | - | 741203..741583 (-) | 381 | WP_002994744.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT70_RS03895 (ETT70_03885) | - | 741587..741934 (-) | 348 | WP_002994741.1 | helix-turn-helix domain-containing protein | - |
| ETT70_RS03900 (ETT70_03890) | - | 742357..742452 (-) | 96 | WP_020837683.1 | type I toxin-antitoxin system Fst family toxin | - |
| ETT70_RS03905 (ETT70_03895) | - | 743088..743279 (+) | 192 | WP_002993390.1 | hypothetical protein | - |
| ETT70_RS03910 (ETT70_03900) | - | 743291..744007 (+) | 717 | WP_002993387.1 | phage antirepressor KilAC domain-containing protein | - |
| ETT70_RS09375 | - | 744020..744151 (+) | 132 | WP_002985401.1 | hypothetical protein | - |
| ETT70_RS03915 (ETT70_03905) | - | 744148..744330 (-) | 183 | WP_011889039.1 | hypothetical protein | - |
| ETT70_RS03920 (ETT70_03910) | - | 744437..744748 (+) | 312 | WP_032461154.1 | hypothetical protein | - |
| ETT70_RS03925 (ETT70_03915) | - | 744750..744935 (+) | 186 | WP_032461153.1 | hypothetical protein | - |
| ETT70_RS03930 (ETT70_03920) | - | 744993..745304 (+) | 312 | WP_345694368.1 | helix-turn-helix domain-containing protein | - |
| ETT70_RS03935 (ETT70_03925) | - | 745405..745818 (+) | 414 | WP_186787907.1 | DnaD domain-containing protein | - |
| ETT70_RS03940 (ETT70_03930) | - | 745799..746032 (+) | 234 | WP_136059307.1 | hypothetical protein | - |
| ETT70_RS03945 (ETT70_03935) | - | 746029..746169 (+) | 141 | WP_011017992.1 | hypothetical protein | - |
| ETT70_RS03950 (ETT70_03940) | - | 746178..746390 (+) | 213 | WP_063629413.1 | hypothetical protein | - |
| ETT70_RS03955 (ETT70_03945) | bet | 746411..747256 (+) | 846 | WP_063629412.1 | phage recombination protein Bet | - |
| ETT70_RS03960 (ETT70_03950) | - | 747266..748294 (+) | 1029 | WP_011888756.1 | DUF1351 domain-containing protein | - |
| ETT70_RS03965 (ETT70_03955) | - | 748491..748832 (+) | 342 | WP_011888757.1 | hypothetical protein | - |
| ETT70_RS03970 (ETT70_03960) | - | 748829..749341 (+) | 513 | WP_032463367.1 | phage protein | - |
| ETT70_RS09380 (ETT70_03965) | - | 749328..749513 (+) | 186 | WP_011017985.1 | hypothetical protein | - |
| ETT70_RS03980 (ETT70_03970) | - | 749518..749787 (+) | 270 | WP_111684751.1 | hypothetical protein | - |
| ETT70_RS03985 (ETT70_03975) | - | 749790..750539 (+) | 750 | WP_080465051.1 | site-specific DNA-methyltransferase | - |
| ETT70_RS03990 (ETT70_03980) | - | 751048..751467 (+) | 420 | WP_111684753.1 | DUF1492 domain-containing protein | - |
| ETT70_RS03995 (ETT70_03985) | - | 751574..751918 (+) | 345 | WP_063629033.1 | HNH endonuclease signature motif containing protein | - |
| ETT70_RS04000 (ETT70_03990) | - | 752067..752423 (+) | 357 | WP_032461152.1 | hypothetical protein | - |
| ETT70_RS04005 (ETT70_03995) | - | 752420..753688 (+) | 1269 | WP_032461151.1 | phage portal protein | - |
| ETT70_RS04010 (ETT70_04000) | - | 753681..755174 (+) | 1494 | WP_011017978.1 | hypothetical protein | - |
| ETT70_RS04015 (ETT70_04005) | - | 755180..755404 (+) | 225 | WP_002994100.1 | hypothetical protein | - |
| ETT70_RS04020 (ETT70_04010) | - | 755454..755633 (+) | 180 | WP_032461150.1 | hypothetical protein | - |
| ETT70_RS04025 (ETT70_04015) | - | 755626..755892 (+) | 267 | WP_002986828.1 | hypothetical protein | - |
| ETT70_RS04030 (ETT70_04020) | - | 755894..756130 (+) | 237 | WP_011888764.1 | hypothetical protein | - |
| ETT70_RS04035 (ETT70_04025) | - | 756212..757627 (+) | 1416 | WP_032461148.1 | terminase | - |
| ETT70_RS04040 (ETT70_04030) | - | 757698..758159 (+) | 462 | WP_136275814.1 | DUF4355 domain-containing protein | - |
| ETT70_RS04045 (ETT70_04035) | - | 758184..759095 (+) | 912 | WP_063631463.1 | phage major capsid protein | - |
| ETT70_RS04050 (ETT70_04040) | - | 759095..759295 (+) | 201 | WP_010922460.1 | hypothetical protein | - |
| ETT70_RS04055 (ETT70_04045) | - | 759305..759727 (+) | 423 | WP_021733479.1 | phage Gp19/Gp15/Gp42 family protein | - |
| ETT70_RS04060 (ETT70_04050) | - | 759687..760025 (+) | 339 | WP_011054681.1 | hypothetical protein | - |
| ETT70_RS04065 (ETT70_04055) | - | 760018..760254 (+) | 237 | WP_111676592.1 | hypothetical protein | - |
| ETT70_RS04070 (ETT70_04060) | - | 760255..760590 (+) | 336 | WP_000573598.1 | hypothetical protein | - |
| ETT70_RS04075 (ETT70_04065) | - | 760602..761186 (+) | 585 | WP_111684757.1 | phage tail protein | - |
| ETT70_RS04080 (ETT70_04070) | - | 761196..761459 (+) | 264 | WP_032461128.1 | hypothetical protein | - |
| ETT70_RS04085 (ETT70_04075) | - | 761474..761845 (+) | 372 | WP_032461127.1 | DUF5361 domain-containing protein | - |
| ETT70_RS04090 (ETT70_04080) | - | 761845..764202 (+) | 2358 | WP_136105733.1 | hypothetical protein | - |
| ETT70_RS04095 (ETT70_04085) | - | 764199..764894 (+) | 696 | WP_111676584.1 | hypothetical protein | - |
| ETT70_RS04100 (ETT70_04090) | - | 764876..766855 (+) | 1980 | WP_168410055.1 | phage tail spike protein | - |
| ETT70_RS04105 (ETT70_04095) | - | 766855..767880 (+) | 1026 | WP_136105732.1 | hyaluronoglucosaminidase | - |
| ETT70_RS04110 (ETT70_04100) | - | 767895..769679 (+) | 1785 | WP_136105731.1 | gp58-like family protein | - |
| ETT70_RS04115 (ETT70_04105) | - | 769691..770119 (+) | 429 | WP_063629045.1 | DUF1617 family protein | - |
| ETT70_RS04120 (ETT70_04110) | - | 770122..770754 (+) | 633 | WP_063629046.1 | hypothetical protein | - |
| ETT70_RS04125 (ETT70_04115) | - | 770765..771064 (+) | 300 | WP_002993162.1 | hypothetical protein | - |
| ETT70_RS04130 (ETT70_04120) | - | 771061..771246 (+) | 186 | WP_111676573.1 | holin | - |
| ETT70_RS04135 (ETT70_04125) | - | 771357..772559 (+) | 1203 | WP_136275815.1 | glucosaminidase domain-containing protein | - |
| ETT70_RS04140 (ETT70_04130) | prx | 773263..773451 (+) | 189 | WP_136105726.1 | Paratox | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7238.14 Da Isoelectric Point: 3.9282
>NTDB_id=341115 ETT70_RS04140 WP_136105726.1 773263..773451(+) (prx) [Streptococcus pyogenes strain emmNA]
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
MLTYDEFKQAIDNGYITADAVMIVRKNGQIFDYVLPHEEIRDWEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=341115 ETT70_RS04140 WP_136105726.1 773263..773451(+) (prx) [Streptococcus pyogenes strain emmNA]
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATACGACGAATTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAGATAAGAGATTGGGAGGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
93.548 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
95.161 |
0.71 |
| prx | Streptococcus pyogenes MGAS315 |
70 |
96.774 |
0.677 |
| prx | Streptococcus pyogenes MGAS8232 |
71.186 |
95.161 |
0.677 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
67.742 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
66.129 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
73.81 |
67.742 |
0.5 |