Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | ETT73_RS05665 | Genome accession | NZ_CP035426 |
| Coordinates | 1109894..1110046 (-) | Length | 50 a.a. |
| NCBI ID | WP_136098756.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm57 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1110190..1153720 | 1109894..1110046 | flank | 144 |
Gene organization within MGE regions
Location: 1109894..1153720
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT73_RS05665 (ETT73_05660) | prx | 1109894..1110046 (-) | 153 | WP_136098756.1 | Paratox | Regulator |
| ETT73_RS05670 (ETT73_05665) | entC3 | 1110190..1110972 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| ETT73_RS05675 (ETT73_05670) | - | 1111220..1112344 (-) | 1125 | WP_023609814.1 | Fic family protein | - |
| ETT73_RS05680 (ETT73_05675) | - | 1112480..1113688 (-) | 1209 | WP_136114597.1 | glucosaminidase domain-containing protein | - |
| ETT73_RS05685 (ETT73_05680) | - | 1113799..1113984 (-) | 186 | WP_011184796.1 | holin | - |
| ETT73_RS05690 (ETT73_05685) | - | 1113981..1114277 (-) | 297 | WP_023078532.1 | hypothetical protein | - |
| ETT73_RS05695 (ETT73_05690) | - | 1114274..1114915 (-) | 642 | WP_136114598.1 | hypothetical protein | - |
| ETT73_RS05700 (ETT73_05695) | - | 1114918..1115349 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| ETT73_RS05705 (ETT73_05700) | - | 1115361..1116416 (-) | 1056 | Protein_1036 | gp58-like family protein | - |
| ETT73_RS05710 (ETT73_05705) | - | 1116368..1118191 (-) | 1824 | WP_227876945.1 | phage tail protein | - |
| ETT73_RS05715 (ETT73_05710) | - | 1118201..1119043 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| ETT73_RS05720 (ETT73_05715) | - | 1119055..1123437 (-) | 4383 | WP_136276591.1 | tape measure protein | - |
| ETT73_RS05725 (ETT73_05720) | - | 1123452..1123685 (-) | 234 | WP_011888930.1 | hypothetical protein | - |
| ETT73_RS05730 (ETT73_05725) | - | 1123760..1124215 (-) | 456 | WP_011888931.1 | tail assembly chaperone | - |
| ETT73_RS05735 (ETT73_05730) | - | 1124269..1124868 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| ETT73_RS05740 (ETT73_05735) | - | 1124880..1125239 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| ETT73_RS05745 (ETT73_05740) | - | 1125243..1125587 (-) | 345 | WP_136276593.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ETT73_RS05750 (ETT73_05745) | - | 1125584..1125862 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| ETT73_RS05755 (ETT73_05750) | - | 1125873..1126229 (-) | 357 | WP_011888932.1 | phage head-tail connector protein | - |
| ETT73_RS05760 (ETT73_05755) | - | 1126241..1127128 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| ETT73_RS05765 (ETT73_05760) | - | 1127141..1127710 (-) | 570 | WP_011888933.1 | DUF4355 domain-containing protein | - |
| ETT73_RS05770 (ETT73_05765) | - | 1127872..1128138 (-) | 267 | WP_011888934.1 | hypothetical protein | - |
| ETT73_RS05775 (ETT73_05770) | - | 1128143..1128331 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| ETT73_RS05780 (ETT73_05775) | - | 1128359..1129807 (-) | 1449 | WP_032465703.1 | minor capsid protein | - |
| ETT73_RS05785 (ETT73_05780) | - | 1129767..1131299 (-) | 1533 | WP_038433243.1 | phage portal protein | - |
| ETT73_RS05790 (ETT73_05785) | - | 1131315..1132592 (-) | 1278 | WP_063632647.1 | PBSX family phage terminase large subunit | - |
| ETT73_RS05795 (ETT73_05790) | - | 1132582..1133034 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| ETT73_RS05800 (ETT73_05795) | - | 1133124..1133540 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| ETT73_RS09045 | - | 1133537..1133911 (-) | 375 | WP_227876946.1 | DUF1642 domain-containing protein | - |
| ETT73_RS09050 | - | 1133918..1134253 (-) | 336 | Protein_1057 | DUF1642 domain-containing protein | - |
| ETT73_RS05810 (ETT73_05805) | - | 1134541..1134726 (-) | 186 | WP_011184603.1 | hypothetical protein | - |
| ETT73_RS05815 (ETT73_05810) | - | 1134751..1135005 (-) | 255 | WP_136276595.1 | hypothetical protein | - |
| ETT73_RS05820 (ETT73_05815) | - | 1134986..1135174 (-) | 189 | WP_015898613.1 | hypothetical protein | - |
| ETT73_RS05825 (ETT73_05820) | - | 1135175..1136497 (-) | 1323 | WP_136114610.1 | SNF2-related protein | - |
| ETT73_RS05830 (ETT73_05825) | - | 1136494..1136769 (-) | 276 | WP_001258483.1 | VRR-NUC domain-containing protein | - |
| ETT73_RS05835 (ETT73_05830) | - | 1137155..1139539 (-) | 2385 | WP_136114611.1 | phage/plasmid primase, P4 family | - |
| ETT73_RS05840 (ETT73_05835) | - | 1139544..1141466 (-) | 1923 | WP_136133652.1 | DNA polymerase | - |
| ETT73_RS05845 (ETT73_05840) | - | 1141509..1142072 (-) | 564 | WP_136114613.1 | DUF2815 family protein | - |
| ETT73_RS05850 (ETT73_05845) | - | 1142081..1143238 (-) | 1158 | WP_115224488.1 | DUF2800 domain-containing protein | - |
| ETT73_RS05855 (ETT73_05850) | - | 1143238..1143537 (-) | 300 | WP_136114614.1 | hypothetical protein | - |
| ETT73_RS05860 (ETT73_05855) | - | 1143626..1143829 (-) | 204 | WP_136114615.1 | hypothetical protein | - |
| ETT73_RS05865 (ETT73_05860) | - | 1143826..1144176 (-) | 351 | WP_038433231.1 | hypothetical protein | - |
| ETT73_RS05870 (ETT73_05865) | - | 1144319..1144706 (-) | 388 | Protein_1070 | hypothetical protein | - |
| ETT73_RS05875 (ETT73_05870) | - | 1144703..1144906 (-) | 204 | WP_136276597.1 | hypothetical protein | - |
| ETT73_RS05880 (ETT73_05875) | - | 1144899..1145069 (-) | 171 | WP_023611037.1 | hypothetical protein | - |
| ETT73_RS05885 (ETT73_05880) | - | 1145071..1145382 (-) | 312 | WP_136276599.1 | excisionase | - |
| ETT73_RS05890 (ETT73_05885) | - | 1145461..1145646 (-) | 186 | WP_032461902.1 | helix-turn-helix domain-containing protein | - |
| ETT73_RS05895 (ETT73_05890) | - | 1145789..1146103 (+) | 315 | WP_032461901.1 | hypothetical protein | - |
| ETT73_RS05900 (ETT73_05895) | - | 1146078..1146428 (-) | 351 | WP_111681188.1 | hypothetical protein | - |
| ETT73_RS05905 (ETT73_05900) | - | 1146485..1146694 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| ETT73_RS05915 (ETT73_05910) | - | 1146940..1147146 (-) | 207 | WP_001157159.1 | helix-turn-helix transcriptional regulator | - |
| ETT73_RS05920 (ETT73_05915) | - | 1147220..1147702 (+) | 483 | WP_021340824.1 | hypothetical protein | - |
| ETT73_RS08920 | - | 1147699..1147845 (-) | 147 | WP_168645150.1 | hypothetical protein | - |
| ETT73_RS05925 (ETT73_05920) | - | 1147900..1148499 (+) | 600 | WP_136114618.1 | hypothetical protein | - |
| ETT73_RS05930 (ETT73_05925) | - | 1148531..1148689 (-) | 159 | WP_076636802.1 | hypothetical protein | - |
| ETT73_RS05935 (ETT73_05930) | - | 1149079..1149837 (+) | 759 | WP_136114619.1 | XRE family transcriptional regulator | - |
| ETT73_RS05940 (ETT73_05935) | - | 1149872..1150552 (+) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT73_RS05945 (ETT73_05940) | - | 1150689..1151831 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| ETT73_RS05950 (ETT73_05945) | - | 1151921..1152196 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| ETT73_RS05955 (ETT73_05950) | - | 1152295..1152882 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| ETT73_RS05960 (ETT73_05955) | - | 1152860..1153702 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 50 a.a. Molecular weight: 5722.53 Da Isoelectric Point: 4.4184
>NTDB_id=340956 ETT73_RS05665 WP_136098756.1 1109894..1110046(-) (prx) [Streptococcus pyogenes strain emm57]
MDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
MDNGYITADTVMIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLVELSR
Nucleotide
Download Length: 153 bp
>NTDB_id=340956 ETT73_RS05665 WP_136098756.1 1109894..1110046(-) (prx) [Streptococcus pyogenes strain emm57]
ATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAACGGACAGATTTTTGATTATGTTTTGCCACA
TGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGGTGCTAGTGGAGCTTTCGAGATAA
ATTGACAATGGATATATCACAGCAGACACAGTTATGATCGTGCGCAAGAACGGACAGATTTTTGATTATGTTTTGCCACA
TGAGAAAGTAAAGAATGGAGAAGTTGTGACAGACGAAAAAGTGGAAGAGGTGCTAGTGGAGCTTTCGAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
90 |
100 |
0.9 |
| prx | Streptococcus pyogenes MGAS8232 |
88 |
100 |
0.88 |
| prx | Streptococcus pyogenes MGAS315 |
74 |
100 |
0.74 |
| prx | Streptococcus pyogenes MGAS315 |
70 |
100 |
0.7 |
| prx | Streptococcus pyogenes MGAS315 |
78.788 |
66 |
0.52 |
| prx | Streptococcus pyogenes MGAS315 |
80.645 |
62 |
0.5 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
64 |
0.48 |