Detailed information
Overview
| Name | clpP | Type | Regulator |
| Locus tag | ES963_RS18565 | Genome accession | NZ_CP035390 |
| Coordinates | 3438821..3439414 (+) | Length | 197 a.a. |
| NCBI ID | WP_003228214.1 | Uniprot ID | A0A199WEF2 |
| Organism | Bacillus subtilis strain SRCM103641 | ||
| Function | degradation of ComK; degradation of DegU (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 3399086..3438522 | 3438821..3439414 | flank | 299 |
Gene organization within MGE regions
Location: 3399086..3439414
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ES963_RS18305 (ES963_18305) | - | 3399278..3399511 (-) | 234 | WP_033881229.1 | helix-turn-helix transcriptional regulator | - |
| ES963_RS18310 (ES963_18310) | - | 3399781..3400068 (+) | 288 | WP_225910697.1 | hypothetical protein | - |
| ES963_RS18315 (ES963_18315) | - | 3400081..3401265 (+) | 1185 | WP_014480972.1 | FtsK/SpoIIIE domain-containing protein | - |
| ES963_RS18320 (ES963_18320) | - | 3401252..3401884 (+) | 633 | WP_129093131.1 | replication-relaxation family protein | - |
| ES963_RS18325 (ES963_18325) | - | 3401926..3402228 (-) | 303 | WP_014480974.1 | hypothetical protein | - |
| ES963_RS18330 (ES963_18330) | - | 3402350..3402607 (-) | 258 | WP_014480975.1 | holin | - |
| ES963_RS18335 (ES963_18335) | - | 3402627..3403574 (-) | 948 | WP_033881228.1 | N-acetylmuramoyl-L-alanine amidase | - |
| ES963_RS18340 (ES963_18340) | - | 3403647..3403850 (-) | 204 | WP_033881227.1 | BhlA/UviB family holin-like peptide | - |
| ES963_RS18345 (ES963_18345) | - | 3403875..3404045 (-) | 171 | WP_129093132.1 | XkdX family protein | - |
| ES963_RS18350 (ES963_18350) | - | 3404046..3404339 (-) | 294 | WP_014480978.1 | hypothetical protein | - |
| ES963_RS18355 (ES963_18355) | - | 3404355..3405578 (-) | 1224 | WP_250635435.1 | BppU family phage baseplate upper protein | - |
| ES963_RS18360 (ES963_18360) | - | 3405615..3407192 (-) | 1578 | WP_129093133.1 | hypothetical protein | - |
| ES963_RS18365 (ES963_18365) | - | 3407205..3408599 (-) | 1395 | WP_031600997.1 | phage tail protein | - |
| ES963_RS18370 (ES963_18370) | - | 3408614..3410032 (-) | 1419 | WP_033880944.1 | glucosaminidase domain-containing protein | - |
| ES963_RS18375 (ES963_18375) | - | 3410036..3412858 (-) | 2823 | WP_129093134.1 | phage tail tape measure protein | - |
| ES963_RS18380 (ES963_18380) | - | 3412863..3413084 (-) | 222 | WP_033880947.1 | hypothetical protein | - |
| ES963_RS18385 (ES963_18385) | - | 3413180..3413563 (-) | 384 | WP_017695225.1 | hypothetical protein | - |
| ES963_RS18390 (ES963_18390) | - | 3413623..3414192 (-) | 570 | WP_033880949.1 | hypothetical protein | - |
| ES963_RS18395 (ES963_18395) | - | 3414233..3414607 (-) | 375 | WP_033880952.1 | minor capsid protein | - |
| ES963_RS18400 (ES963_18400) | - | 3414612..3415019 (-) | 408 | WP_033880954.1 | hypothetical protein | - |
| ES963_RS18405 (ES963_18405) | - | 3415016..3415339 (-) | 324 | WP_228224819.1 | hypothetical protein | - |
| ES963_RS18410 (ES963_18410) | - | 3415355..3415747 (-) | 393 | WP_031601003.1 | hypothetical protein | - |
| ES963_RS18415 (ES963_18415) | - | 3415765..3415956 (-) | 192 | WP_033880957.1 | hypothetical protein | - |
| ES963_RS18420 (ES963_18420) | - | 3416013..3416921 (-) | 909 | WP_129093135.1 | major capsid protein | - |
| ES963_RS18425 (ES963_18425) | - | 3416953..3417513 (-) | 561 | WP_129093136.1 | ribonucleoside-triphosphate reductase | - |
| ES963_RS18430 (ES963_18430) | - | 3417619..3418431 (-) | 813 | WP_129093137.1 | phage minor capsid protein | - |
| ES963_RS18435 (ES963_18435) | - | 3418431..3420101 (-) | 1671 | WP_031601006.1 | phage portal protein | - |
| ES963_RS18440 (ES963_18440) | - | 3420106..3420540 (-) | 435 | WP_031601007.1 | phBC6A51 family helix-turn-helix protein | - |
| ES963_RS18445 (ES963_18445) | terL | 3420557..3422317 (-) | 1761 | WP_129093138.1 | phage terminase large subunit | - |
| ES963_RS18450 (ES963_18450) | - | 3422401..3422949 (+) | 549 | WP_033880961.1 | site-specific integrase | - |
| ES963_RS18455 (ES963_18455) | - | 3422979..3423188 (-) | 210 | WP_031601009.1 | hypothetical protein | - |
| ES963_RS22185 | - | 3423720..3423881 (-) | 162 | WP_164971719.1 | hypothetical protein | - |
| ES963_RS18460 (ES963_18460) | - | 3423883..3424149 (-) | 267 | WP_077736277.1 | hypothetical protein | - |
| ES963_RS18465 (ES963_18465) | - | 3424411..3424590 (-) | 180 | WP_033880962.1 | hypothetical protein | - |
| ES963_RS18470 (ES963_18470) | - | 3425633..3426175 (-) | 543 | WP_031601012.1 | hypothetical protein | - |
| ES963_RS18475 (ES963_18475) | - | 3426172..3426450 (-) | 279 | WP_017695241.1 | hypothetical protein | - |
| ES963_RS22525 | - | 3426447..3427238 (-) | 792 | WP_017695242.1 | hypothetical protein | - |
| ES963_RS18485 (ES963_18485) | - | 3427311..3427682 (-) | 372 | WP_129093139.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| ES963_RS22635 (ES963_18490) | - | 3428130..3428378 (-) | 249 | WP_129093140.1 | helix-turn-helix transcriptional regulator | - |
| ES963_RS18495 (ES963_18495) | - | 3428851..3429051 (-) | 201 | WP_129093141.1 | hypothetical protein | - |
| ES963_RS18500 (ES963_18500) | - | 3429044..3429370 (-) | 327 | WP_129093142.1 | hypothetical protein | - |
| ES963_RS18505 (ES963_18505) | - | 3429408..3429950 (-) | 543 | WP_129093143.1 | hypothetical protein | - |
| ES963_RS22190 | - | 3429943..3430080 (-) | 138 | WP_164971720.1 | hypothetical protein | - |
| ES963_RS18510 (ES963_18510) | - | 3430484..3431659 (-) | 1176 | WP_129093144.1 | AimR family lysis-lysogeny pheromone receptor | - |
| ES963_RS18515 (ES963_18515) | - | 3431779..3431994 (+) | 216 | WP_129093145.1 | helix-turn-helix transcriptional regulator | - |
| ES963_RS18520 (ES963_18520) | - | 3432186..3432521 (-) | 336 | WP_129093146.1 | hypothetical protein | - |
| ES963_RS18525 (ES963_18525) | - | 3432707..3432946 (+) | 240 | WP_129093147.1 | helix-turn-helix domain-containing protein | - |
| ES963_RS18530 (ES963_18530) | - | 3433091..3434071 (-) | 981 | WP_129093148.1 | tyrosine-type recombinase/integrase | - |
| ES963_RS18535 (ES963_18535) | - | 3434702..3435511 (-) | 810 | WP_129093149.1 | RNA ligase family protein | - |
| ES963_RS18540 (ES963_18540) | - | 3435598..3436020 (-) | 423 | WP_129093150.1 | hypothetical protein | - |
| ES963_RS18545 (ES963_18545) | - | 3436036..3436218 (-) | 183 | WP_129093151.1 | hypothetical protein | - |
| ES963_RS18550 (ES963_18550) | - | 3436392..3437126 (-) | 735 | WP_129093199.1 | helix-turn-helix domain-containing protein | - |
| ES963_RS18555 (ES963_18555) | - | 3437286..3438275 (-) | 990 | WP_014480981.1 | tyrosine-type recombinase/integrase | - |
| ES963_RS18565 (ES963_18565) | clpP | 3438821..3439414 (+) | 594 | WP_003228214.1 | ATP-dependent Clp endopeptidase proteolytic subunit ClpP | Regulator |
Sequence
Protein
Download Length: 197 a.a. Molecular weight: 21682.00 Da Isoelectric Point: 4.9416
>NTDB_id=339568 ES963_RS18565 WP_003228214.1 3438821..3439414(+) (clpP) [Bacillus subtilis strain SRCM103641]
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ
PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK
MNLIPTVIEQTNRGERAYDIYSRLLKDRIIMLGSAIDDNVANSIVSQLLFLAAEDPEKEISLYINSPGGSITAGMAIYDT
MQFIKPKVSTICIGMAASMGAFLLAAGEKGKRYALPNSEVMIHQPLGGAQGQATEIEIAAKRILLLRDKLNKVLAERTGQ
PLEVIERDTDRDNFKSAEEALEYGLIDKILTHTEDKK
Nucleotide
Download Length: 594 bp
>NTDB_id=339568 ES963_RS18565 WP_003228214.1 3438821..3439414(+) (clpP) [Bacillus subtilis strain SRCM103641]
ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA
TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG
AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC
ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG
CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA
CAGAAATTGAAATTGCCGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTTGCTGAACGTACTGGCCAG
CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA
CAAAATTTTGACTCACACAGAAGACAAAAAGTAA
ATGAATTTAATACCTACAGTCATTGAACAAACGAACCGCGGGGAAAGAGCGTATGACATTTATTCTCGTCTATTAAAGGA
TCGTATCATCATGCTTGGATCTGCGATTGATGACAACGTTGCGAACTCCATCGTGTCACAGCTTTTATTCTTAGCAGCAG
AAGACCCTGAAAAAGAAATTTCTCTTTACATCAACAGCCCGGGCGGCTCTATTACAGCCGGTATGGCGATCTATGATACC
ATGCAGTTTATTAAGCCGAAGGTATCTACAATTTGTATCGGTATGGCTGCGTCAATGGGCGCGTTCCTGCTTGCAGCCGG
CGAAAAAGGCAAACGCTATGCGCTTCCAAACAGTGAAGTCATGATTCACCAGCCTCTTGGCGGTGCGCAAGGTCAAGCGA
CAGAAATTGAAATTGCCGCGAAACGCATTCTCTTGCTTCGCGACAAATTAAACAAAGTCCTTGCTGAACGTACTGGCCAG
CCGCTTGAAGTGATCGAACGCGACACAGACCGTGATAACTTCAAGTCTGCTGAAGAAGCGCTTGAATACGGCCTGATTGA
CAAAATTTTGACTCACACAGAAGACAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| clpP | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |
| clpP | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
68.617 |
95.431 |
0.655 |
| clpP | Streptococcus thermophilus LMG 18311 |
58.163 |
99.492 |
0.579 |
| clpP | Streptococcus thermophilus LMD-9 |
58.163 |
99.492 |
0.579 |
| clpP | Streptococcus pneumoniae D39 |
57.812 |
97.462 |
0.563 |
| clpP | Streptococcus pneumoniae Rx1 |
57.812 |
97.462 |
0.563 |
| clpP | Streptococcus pneumoniae R6 |
57.812 |
97.462 |
0.563 |
| clpP | Streptococcus pneumoniae TIGR4 |
57.812 |
97.462 |
0.563 |
| clpP | Lactococcus lactis subsp. cremoris KW2 |
57.895 |
96.447 |
0.558 |
| clpP | Streptococcus pyogenes JRS4 |
56.122 |
99.492 |
0.558 |
| clpP | Streptococcus pyogenes MGAS315 |
56.122 |
99.492 |
0.558 |
| clpP | Streptococcus mutans UA159 |
54.822 |
100 |
0.548 |
| clpP | Lactococcus lactis subsp. lactis strain DGCC12653 |
55.789 |
96.447 |
0.538 |