Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | SEQ_RS08425 | Genome accession | NC_012471 |
| Coordinates | 1742042..1742227 (-) | Length | 61 a.a. |
| NCBI ID | WP_012679954.1 | Uniprot ID | C0M6G1 |
| Organism | Streptococcus equi subsp. equi 4047 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1742042..1772823 | 1742042..1742227 | within | 0 |
Gene organization within MGE regions
Location: 1742042..1772823
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SEQ_RS08425 (SEQ_1726) | prx | 1742042..1742227 (-) | 186 | WP_012679954.1 | hypothetical protein | Regulator |
| SEQ_RS08430 (SEQ_1727) | spel | 1742349..1743137 (-) | 789 | WP_012679955.1 | streptococcal pyrogenic exotoxin SpeL | - |
| SEQ_RS08435 (SEQ_1728) | spek | 1743404..1744183 (-) | 780 | WP_012679956.1 | streptococcal pyrogenic exotoxin SpeK | - |
| SEQ_RS08440 (SEQ_1729) | - | 1744308..1745537 (-) | 1230 | WP_012679957.1 | glucosaminidase domain-containing protein | - |
| SEQ_RS08445 (SEQ_1730) | - | 1745649..1745828 (-) | 180 | WP_012679339.1 | holin | - |
| SEQ_RS08450 (SEQ_1731) | - | 1745831..1746121 (-) | 291 | WP_012679338.1 | hypothetical protein | - |
| SEQ_RS08455 (SEQ_1732) | - | 1746134..1746748 (-) | 615 | WP_012679958.1 | DUF1366 domain-containing protein | - |
| SEQ_RS08460 (SEQ_1733) | - | 1746751..1747182 (-) | 432 | WP_012679959.1 | DUF1617 family protein | - |
| SEQ_RS08465 (SEQ_1734) | - | 1747191..1749095 (-) | 1905 | WP_012679960.1 | gp58-like family protein | - |
| SEQ_RS08470 (SEQ_1735) | - | 1749106..1749720 (-) | 615 | WP_012679961.1 | hypothetical protein | - |
| SEQ_RS08475 (SEQ_1736) | - | 1749722..1750429 (-) | 708 | WP_012679962.1 | collagen-like protein | - |
| SEQ_RS08480 (SEQ_1737) | - | 1750429..1752486 (-) | 2058 | WP_012679963.1 | phage tail spike protein | - |
| SEQ_RS08485 (SEQ_1738) | - | 1752483..1753262 (-) | 780 | WP_012679964.1 | distal tail protein Dit | - |
| SEQ_RS08490 (SEQ_1739) | - | 1753294..1756548 (-) | 3255 | WP_012679965.1 | tape measure protein | - |
| SEQ_RS08495 (SEQ_1740) | - | 1756565..1756861 (-) | 297 | WP_230197423.1 | hypothetical protein | - |
| SEQ_RS08500 (SEQ_1741) | - | 1756936..1757295 (-) | 360 | WP_012679967.1 | tail assembly chaperone | - |
| SEQ_RS08505 (SEQ_1743) | - | 1757357..1757882 (-) | 526 | Protein_1634 | phage major tail protein, TP901-1 family | - |
| SEQ_RS08510 (SEQ_1744) | - | 1757958..1758347 (-) | 390 | WP_012679970.1 | hypothetical protein | - |
| SEQ_RS08515 (SEQ_1745) | - | 1758344..1758709 (-) | 366 | WP_012679971.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SEQ_RS08520 (SEQ_1746) | - | 1758690..1758998 (-) | 309 | WP_012679972.1 | hypothetical protein | - |
| SEQ_RS08525 (SEQ_1747) | - | 1758995..1759348 (-) | 354 | WP_012679973.1 | phage head-tail connector protein | - |
| SEQ_RS08530 (SEQ_1748) | - | 1759358..1759624 (-) | 267 | WP_012679974.1 | HeH/LEM domain-containing protein | - |
| SEQ_RS08535 (SEQ_1749) | - | 1759635..1760684 (-) | 1050 | WP_012679975.1 | major capsid protein | - |
| SEQ_RS08540 (SEQ_1750) | - | 1760687..1761067 (-) | 381 | WP_012679976.1 | head decoration protein | - |
| SEQ_RS08545 (SEQ_1751) | - | 1761078..1761701 (-) | 624 | WP_042357153.1 | DUF4355 domain-containing protein | - |
| SEQ_RS11620 (SEQ_1752) | - | 1761883..1762050 (-) | 168 | WP_012679978.1 | hypothetical protein | - |
| SEQ_RS08550 (SEQ_1753) | - | 1762086..1762355 (-) | 270 | WP_012679979.1 | hypothetical protein | - |
| SEQ_RS08555 (SEQ_1755) | - | 1762552..1762971 (-) | 420 | WP_012679981.1 | HD domain-containing protein | - |
| SEQ_RS08560 (SEQ_1756) | - | 1762968..1763174 (-) | 207 | WP_003052398.1 | hypothetical protein | - |
| SEQ_RS08565 (SEQ_1757) | - | 1763176..1764753 (-) | 1578 | WP_042357165.1 | phage head morphogenesis protein | - |
| SEQ_RS08570 (SEQ_1758) | - | 1764734..1766236 (-) | 1503 | WP_012679983.1 | phage portal protein | - |
| SEQ_RS08575 (SEQ_1759) | - | 1766248..1767495 (-) | 1248 | WP_012679984.1 | PBSX family phage terminase large subunit | - |
| SEQ_RS08590 (SEQ_1762) | - | 1769086..1769874 (+) | 789 | WP_012679985.1 | helix-turn-helix transcriptional regulator | - |
| SEQ_RS08595 (SEQ_1763) | - | 1769883..1771052 (+) | 1170 | WP_012679986.1 | DUF4041 domain-containing protein | - |
| SEQ_RS08600 (SEQ_1764) | - | 1771055..1771258 (+) | 204 | WP_012679987.1 | hypothetical protein | - |
| SEQ_RS08605 (SEQ_1765) | - | 1771390..1772823 (+) | 1434 | WP_012679988.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 6981.00 Da Isoelectric Point: 3.8428
>NTDB_id=33535 SEQ_RS08425 WP_012679954.1 1742042..1742227(-) (prx) [Streptococcus equi subsp. equi 4047]
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
MLTYEEFKQAIDHGYITGDVVMIVRKNGQIFDYVLPGEEVQPWEVVTVEAVADILNELQII
Nucleotide
Download Length: 186 bp
>NTDB_id=33535 SEQ_RS08425 WP_012679954.1 1742042..1742227(-) (prx) [Streptococcus equi subsp. equi 4047]
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
ATGCTAACATACGAGGAATTTAAGCAAGCTATTGATCATGGATATATCACAGGAGACGTGGTCATGATCGTGCGTAAAAA
CGGACAGATATTTGATTATGTGTTGCCAGGGGAGGAAGTGCAGCCTTGGGAAGTGGTGACAGTCGAGGCAGTTGCTGATA
TTTTAAACGAATTACAAATTATTTGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
74.138 |
95.082 |
0.705 |
| prx | Streptococcus pyogenes MGAS315 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS8232 |
69.492 |
96.721 |
0.672 |
| prx | Streptococcus pyogenes MGAS315 |
67.241 |
95.082 |
0.639 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
68.852 |
0.574 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
67.213 |
0.557 |
| prx | Streptococcus pyogenes MGAS315 |
70.732 |
67.213 |
0.475 |