Detailed information
Bioinformatically predicted
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | SPJ_RS11220 | Genome accession | NC_012466 |
| Coordinates | 2117152..2117277 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799694.1 | Uniprot ID | Q9WW44 |
| Organism | Streptococcus pneumoniae JJA | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2112152..2122277
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPJ_RS13620 | - | 2112490..2114093 (-) | 1604 | Protein_2106 | YhgE/Pip domain-containing protein | - |
| SPJ_RS11195 (SPJ_2261) | - | 2114272..2114814 (+) | 543 | WP_001158269.1 | TetR/AcrR family transcriptional regulator | - |
| SPJ_RS11210 (SPJ_2264) | comE | 2115057..2115809 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| SPJ_RS11215 (SPJ_2265) | comD/comD2 | 2115806..2117131 (-) | 1326 | WP_000364843.1 | competence system sensor histidine kinase ComD | Regulator |
| SPJ_RS11220 (SPJ_2266) | comC/comC2 | 2117152..2117277 (-) | 126 | WP_000799694.1 | competence-stimulating peptide ComC | Regulator |
| SPJ_RS11230 (SPJ_2268) | rlmH | 2117559..2118038 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| SPJ_RS11235 (SPJ_2269) | htrA | 2118221..2119402 (+) | 1182 | WP_000681598.1 | S1C family serine protease | Regulator |
| SPJ_RS11240 (SPJ_2270) | spo0J | 2119460..2120218 (+) | 759 | WP_000410383.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4892.93 Da Isoelectric Point: 10.9061
>NTDB_id=33200 SPJ_RS11220 WP_000799694.1 2117152..2117277(-) (comC/comC2) [Streptococcus pneumoniae JJA]
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQNIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=33200 SPJ_RS11220 WP_000799694.1 2117152..2117277(-) (comC/comC2) [Streptococcus pneumoniae JJA]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAATATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
97.561 |
100 |
0.976 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
97.561 |
100 |
0.976 |
| comC/comC1 | Streptococcus pneumoniae R6 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae G54 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae D39 |
78.049 |
100 |
0.78 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
78.049 |
100 |
0.78 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
60 |
97.561 |
0.585 |