Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | DNK17_RS06455 | Genome accession | NZ_CP034315 |
| Coordinates | 1185883..1186071 (+) | Length | 62 a.a. |
| NCBI ID | WP_000027835.1 | Uniprot ID | A0AAV3JNT7 |
| Organism | Streptococcus agalactiae strain TFJ0901 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1176693..1185841 | 1185883..1186071 | flank | 42 |
| IS/Tn | 1184837..1185448 | 1185883..1186071 | flank | 435 |
Gene organization within MGE regions
Location: 1176693..1186071
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DNK17_RS06390 (DNK17_06390) | - | 1176693..1176959 (-) | 267 | WP_001872365.1 | hypothetical protein | - |
| DNK17_RS10915 | - | 1176980..1178342 (+) | 1363 | Protein_1133 | IS3 family transposase | - |
| DNK17_RS06415 (DNK17_06415) | - | 1178515..1178676 (-) | 162 | WP_000508795.1 | NINE protein | - |
| DNK17_RS06420 (DNK17_06420) | - | 1179418..1180695 (+) | 1278 | WP_000594368.1 | ABC transporter permease | - |
| DNK17_RS06425 (DNK17_06425) | - | 1180705..1181361 (+) | 657 | WP_000353149.1 | ABC transporter ATP-binding protein | - |
| DNK17_RS06430 (DNK17_06430) | - | 1181361..1182737 (+) | 1377 | WP_000594351.1 | FtsX-like permease family protein | - |
| DNK17_RS06435 (DNK17_06435) | - | 1182834..1183487 (+) | 654 | WP_000699093.1 | response regulator transcription factor | - |
| DNK17_RS06440 (DNK17_06440) | - | 1183484..1184785 (+) | 1302 | WP_000734168.1 | HAMP domain-containing sensor histidine kinase | - |
| DNK17_RS06445 (DNK17_06445) | - | 1184837..1185484 (-) | 648 | Protein_1140 | IS3 family transposase | - |
| DNK17_RS06450 (DNK17_06450) | - | 1185662..1185841 (+) | 180 | WP_000076709.1 | CsbD family protein | - |
| DNK17_RS06455 (DNK17_06455) | prx | 1185883..1186071 (+) | 189 | WP_000027835.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7180.25 Da Isoelectric Point: 4.7815
>NTDB_id=330671 DNK17_RS06455 WP_000027835.1 1185883..1186071(+) (prx) [Streptococcus agalactiae strain TFJ0901]
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
MSIRTDIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLLHEEVREEEVVTVERVLDVLRKLS
Nucleotide
Download Length: 189 bp
>NTDB_id=330671 DNK17_RS06455 WP_000027835.1 1185883..1186071(+) (prx) [Streptococcus agalactiae strain TFJ0901]
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
TTGTCTATCAGAACAGATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGT
GCGTAAAAACGGAAAGATATTTGATTATGTGTTACTACACGAAGAAGTGAGAGAAGAAGAGGTTGTTACAGTTGAGAGAG
TGCTTGATGTACTGAGGAAGTTATCATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
72.222 |
87.097 |
0.629 |
| prx | Streptococcus pyogenes MGAS8232 |
69.091 |
88.71 |
0.613 |
| prx | Streptococcus pyogenes MGAS315 |
66.667 |
87.097 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
85 |
64.516 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
61.818 |
88.71 |
0.548 |
| prx | Streptococcus pyogenes MGAS315 |
74.359 |
62.903 |
0.468 |
| prx | Streptococcus pyogenes MGAS315 |
78.378 |
59.677 |
0.468 |