Detailed information
Overview
| Name | prx | Type | Regulator |
| Locus tag | EHF39_RS06510 | Genome accession | NZ_CP033908 |
| Coordinates | 1246288..1246470 (-) | Length | 60 a.a. |
| NCBI ID | WP_011528776.1 | Uniprot ID | A0A660A5W9 |
| Organism | Streptococcus pyogenes strain RLGH | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1246288..1274591 | 1246288..1246470 | within | 0 |
Gene organization within MGE regions
Location: 1246288..1274591
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EHF39_RS06510 (EHF39_06510) | prx | 1246288..1246470 (-) | 183 | WP_011528776.1 | hypothetical protein | Regulator |
| EHF39_RS06515 (EHF39_06515) | entC3 | 1246583..1247365 (-) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| EHF39_RS06520 (EHF39_06520) | - | 1247613..1248737 (-) | 1125 | WP_002988467.1 | Fic family protein | - |
| EHF39_RS06525 (EHF39_06525) | - | 1248873..1250090 (-) | 1218 | WP_011528778.1 | peptidoglycan amidohydrolase family protein | - |
| EHF39_RS06530 (EHF39_06530) | - | 1250209..1250436 (-) | 228 | WP_003058873.1 | phage holin | - |
| EHF39_RS06535 (EHF39_06535) | - | 1250433..1250705 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| EHF39_RS06540 (EHF39_06540) | - | 1250717..1251349 (-) | 633 | WP_011528779.1 | hypothetical protein | - |
| EHF39_RS06545 (EHF39_06545) | - | 1251352..1251780 (-) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| EHF39_RS06550 (EHF39_06550) | - | 1251789..1253570 (-) | 1782 | WP_011528781.1 | gp58-like family protein | - |
| EHF39_RS06555 (EHF39_06555) | hylP | 1253585..1254700 (-) | 1116 | WP_011528782.1 | hyaluronoglucosaminidase | - |
| EHF39_RS06560 (EHF39_06560) | - | 1254697..1256673 (-) | 1977 | WP_011528783.1 | phage tail spike protein | - |
| EHF39_RS06565 (EHF39_06565) | - | 1256655..1257350 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| EHF39_RS06570 (EHF39_06570) | - | 1257347..1259704 (-) | 2358 | WP_011528784.1 | hypothetical protein | - |
| EHF39_RS06575 (EHF39_06575) | - | 1259704..1260075 (-) | 372 | WP_011528785.1 | DUF5361 domain-containing protein | - |
| EHF39_RS06580 (EHF39_06580) | - | 1260090..1260353 (-) | 264 | WP_003047548.1 | hypothetical protein | - |
| EHF39_RS06585 (EHF39_06585) | - | 1260364..1260942 (-) | 579 | WP_014635577.1 | hypothetical protein | - |
| EHF39_RS06595 (EHF39_06595) | - | 1261066..1261401 (-) | 336 | WP_011528787.1 | hypothetical protein | - |
| EHF39_RS06600 (EHF39_06600) | - | 1261402..1261638 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| EHF39_RS06605 (EHF39_06605) | - | 1261631..1261968 (-) | 338 | Protein_1223 | hypothetical protein | - |
| EHF39_RS06610 (EHF39_06610) | - | 1261928..1262350 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| EHF39_RS06615 (EHF39_06615) | - | 1262360..1262560 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| EHF39_RS06620 (EHF39_06620) | - | 1262560..1263471 (-) | 912 | WP_011528788.1 | phage major capsid protein | - |
| EHF39_RS06625 (EHF39_06625) | - | 1263496..1263957 (-) | 462 | WP_010922462.1 | DUF4355 domain-containing protein | - |
| EHF39_RS06630 (EHF39_06630) | - | 1264037..1265452 (-) | 1416 | WP_021299324.1 | phage terminase large subunit-like protein | - |
| EHF39_RS06635 (EHF39_06635) | - | 1265534..1265770 (-) | 237 | Protein_1229 | hypothetical protein | - |
| EHF39_RS06640 (EHF39_06640) | - | 1265772..1266038 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| EHF39_RS06645 (EHF39_06645) | - | 1266090..1266314 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| EHF39_RS06650 (EHF39_06650) | - | 1266320..1267813 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| EHF39_RS06655 (EHF39_06655) | - | 1267806..1269074 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| EHF39_RS06660 (EHF39_06660) | - | 1269071..1269427 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| EHF39_RS06665 (EHF39_06665) | - | 1269575..1269919 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| EHF39_RS06670 (EHF39_06670) | - | 1270027..1270446 (-) | 420 | WP_011528791.1 | DUF1492 domain-containing protein | - |
| EHF39_RS06675 (EHF39_06675) | - | 1270607..1270952 (-) | 346 | Protein_1237 | recombinase RecT | - |
| EHF39_RS06680 (EHF39_06680) | - | 1270955..1271284 (-) | 330 | WP_011528796.1 | hypothetical protein | - |
| EHF39_RS06685 (EHF39_06685) | - | 1271340..1271546 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| EHF39_RS06690 (EHF39_06690) | - | 1271555..1271695 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| EHF39_RS06695 (EHF39_06695) | - | 1271692..1271926 (-) | 235 | Protein_1241 | hypothetical protein | - |
| EHF39_RS09960 (EHF39_06700) | - | 1271907..1272110 (-) | 204 | Protein_1242 | DNA replication protein | - |
| EHF39_RS06705 (EHF39_06705) | - | 1272107..1272703 (+) | 597 | Protein_1243 | site-specific integrase | - |
| EHF39_RS06710 (EHF39_06710) | - | 1272792..1273067 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| EHF39_RS06715 (EHF39_06715) | - | 1273166..1273753 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| EHF39_RS06720 (EHF39_06720) | - | 1273731..1274573 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6840.81 Da Isoelectric Point: 4.7023
>NTDB_id=326978 EHF39_RS06510 WP_011528776.1 1246288..1246470(-) (prx) [Streptococcus pyogenes strain RLGH]
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
MLTYNEFKQAIDNGYIAGDTVAIVRKDGQIFDYVLPHEKVKNGEVVTKEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=326978 EHF39_RS06510 WP_011528776.1 1246288..1246470(-) (prx) [Streptococcus pyogenes strain RLGH]
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACAACGAGTTTAAGCAAGCGATTGACAATGGATATATCGCAGGCGATACAGTAGCGATCGTGCGTAAAGA
CGGACAGATTTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACTAAGGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
98.333 |
100 |
0.983 |
| prx | Streptococcus pyogenes MGAS315 |
83.333 |
100 |
0.833 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
100 |
0.717 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
81.395 |
71.667 |
0.583 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |