Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EHF39_RS04700 | Genome accession | NZ_CP033908 |
| Coordinates | 866839..867027 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain RLGH | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 834804..873619 | 866839..867027 | within | 0 |
Gene organization within MGE regions
Location: 834804..873619
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EHF39_RS04500 (EHF39_04500) | - | 834804..835439 (+) | 636 | WP_002990114.1 | cystathionine beta-lyase | - |
| EHF39_RS04505 (EHF39_04505) | rnz | 835454..836383 (+) | 930 | WP_009881223.1 | ribonuclease Z | - |
| EHF39_RS04510 (EHF39_04510) | - | 836383..837147 (+) | 765 | WP_002984893.1 | SDR family oxidoreductase | - |
| EHF39_RS04515 (EHF39_04515) | recJ | 837144..839354 (+) | 2211 | WP_011528535.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EHF39_RS04520 (EHF39_04520) | - | 839505..840023 (+) | 519 | WP_002990109.1 | adenine phosphoribosyltransferase | - |
| EHF39_RS04525 (EHF39_04525) | - | 840104..840787 (+) | 684 | WP_011184446.1 | DnaD domain-containing protein | - |
| EHF39_RS04530 (EHF39_04530) | nth | 840784..841440 (+) | 657 | WP_002990106.1 | endonuclease III | - |
| EHF39_RS04535 (EHF39_04535) | - | 841512..842198 (+) | 687 | WP_002990104.1 | tRNA (adenine(22)-N(1))-methyltransferase TrmK | - |
| EHF39_RS04540 (EHF39_04540) | - | 842188..842976 (+) | 789 | WP_021299315.1 | Nif3-like dinuclear metal center hexameric protein | - |
| EHF39_RS04545 (EHF39_04545) | - | 843016..844122 (+) | 1107 | WP_011528537.1 | FAD-dependent oxidoreductase | - |
| EHF39_RS04550 (EHF39_04550) | rfbA | 844180..845049 (+) | 870 | WP_002992970.1 | glucose-1-phosphate thymidylyltransferase RfbA | - |
| EHF39_RS04555 (EHF39_04555) | - | 845049..845642 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| EHF39_RS04560 (EHF39_04560) | rfbB | 845886..846926 (+) | 1041 | WP_002984881.1 | dTDP-glucose 4,6-dehydratase | - |
| EHF39_RS04565 (EHF39_04565) | - | 847009..847944 (-) | 936 | WP_060388510.1 | site-specific integrase | - |
| EHF39_RS04570 (EHF39_04570) | - | 848091..848411 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| EHF39_RS04575 (EHF39_04575) | - | 848395..848751 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| EHF39_RS10170 (EHF39_04580) | - | 848748..848999 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| EHF39_RS04585 (EHF39_04585) | - | 849008..849217 (+) | 210 | Protein_835 | DUF4355 domain-containing protein | - |
| EHF39_RS04590 (EHF39_04590) | - | 849236..850126 (+) | 891 | WP_011528556.1 | hypothetical protein | - |
| EHF39_RS04595 (EHF39_04595) | - | 850138..850431 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| EHF39_RS04600 (EHF39_04600) | - | 850445..850789 (+) | 345 | WP_060388512.1 | hypothetical protein | - |
| EHF39_RS04605 (EHF39_04605) | - | 850786..851097 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| EHF39_RS04610 (EHF39_04610) | - | 851094..851489 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| EHF39_RS04615 (EHF39_04615) | - | 851491..851901 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| EHF39_RS04620 (EHF39_04620) | - | 851913..852170 (+) | 258 | WP_121158086.1 | phage major tail protein, TP901-1 family | - |
| EHF39_RS04625 (EHF39_04625) | - | 852183..852473 (+) | 291 | WP_060388513.1 | hypothetical protein | - |
| EHF39_RS04630 (EHF39_04630) | - | 852430..854007 (+) | 1578 | WP_231494234.1 | phage tail protein | - |
| EHF39_RS04635 (EHF39_04635) | - | 854008..855492 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| EHF39_RS04640 (EHF39_04640) | - | 855493..858942 (+) | 3450 | WP_011528567.1 | glucosaminidase domain-containing protein | - |
| EHF39_RS04645 (EHF39_04645) | - | 858947..860809 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| EHF39_RS04650 (EHF39_04650) | - | 860820..861167 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| EHF39_RS10130 | - | 861181..861303 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| EHF39_RS04655 (EHF39_04655) | - | 861317..861640 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| EHF39_RS04660 (EHF39_04660) | - | 861640..861972 (+) | 333 | WP_011054798.1 | phage holin | - |
| EHF39_RS04665 (EHF39_04665) | - | 861974..862738 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| EHF39_RS04670 (EHF39_04670) | - | 862750..863352 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| EHF39_RS04675 (EHF39_04675) | - | 863363..864136 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| EHF39_RS04680 (EHF39_04680) | - | 864146..864367 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| EHF39_RS04685 (EHF39_04685) | - | 864367..865026 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| EHF39_RS04690 (EHF39_04690) | - | 865095..865529 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| EHF39_RS04695 (EHF39_04695) | sda3 | 865801..866601 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EHF39_RS04700 (EHF39_04700) | prx | 866839..867027 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| EHF39_RS04705 (EHF39_04705) | - | 867435..867911 (+) | 477 | WP_002984880.1 | 8-oxo-dGTP diphosphatase | - |
| EHF39_RS04710 (EHF39_04710) | - | 867969..869150 (+) | 1182 | WP_002984879.1 | AI-2E family transporter | - |
| EHF39_RS04715 (EHF39_04715) | - | 869140..870387 (+) | 1248 | WP_002984878.1 | tetratricopeptide repeat protein | - |
| EHF39_RS04720 (EHF39_04720) | fbp54 | 870446..872098 (-) | 1653 | WP_021299312.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| EHF39_RS04725 (EHF39_04725) | trpX | 872452..873450 (+) | 999 | WP_011184452.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=326972 EHF39_RS04700 WP_011528571.1 866839..867027(+) (prx) [Streptococcus pyogenes strain RLGH]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=326972 EHF39_RS04700 WP_011528571.1 866839..867027(+) (prx) [Streptococcus pyogenes strain RLGH]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |