Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX80_RS09115 | Genome accession | NZ_CP033815 |
| Coordinates | 1727612..1727800 (+) | Length | 62 a.a. |
| NCBI ID | WP_011054546.1 | Uniprot ID | A0A5S4TJS4 |
| Organism | Streptococcus pyogenes strain FDAARGOS_514 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1688219..1729921 | 1727612..1727800 | within | 0 |
Gene organization within MGE regions
Location: 1688219..1729921
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX80_RS08840 (EGX80_08855) | - | 1688219..1689415 (-) | 1197 | WP_011017350.1 | site-specific integrase | - |
| EGX80_RS08845 (EGX80_08860) | - | 1689726..1690466 (-) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| EGX80_RS08850 (EGX80_08865) | - | 1690477..1690869 (-) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EGX80_RS08855 (EGX80_08870) | - | 1690873..1691223 (-) | 351 | WP_011017353.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS08860 (EGX80_08875) | - | 1691512..1691787 (+) | 276 | WP_011017354.1 | hypothetical protein | - |
| EGX80_RS08865 (EGX80_08880) | - | 1691822..1692034 (+) | 213 | WP_011054420.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS10355 | - | 1692108..1692242 (+) | 135 | WP_011017356.1 | hypothetical protein | - |
| EGX80_RS08870 (EGX80_08885) | - | 1692362..1692871 (-) | 510 | WP_011106801.1 | hypothetical protein | - |
| EGX80_RS08875 (EGX80_08890) | - | 1692913..1693632 (+) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| EGX80_RS08880 (EGX80_08895) | - | 1693706..1693963 (+) | 258 | WP_011054421.1 | hypothetical protein | - |
| EGX80_RS08885 (EGX80_08900) | - | 1694056..1694247 (+) | 192 | WP_011017359.1 | hypothetical protein | - |
| EGX80_RS08890 (EGX80_08905) | - | 1694368..1694556 (+) | 189 | WP_032461348.1 | hypothetical protein | - |
| EGX80_RS08895 (EGX80_08910) | dnaB | 1694528..1695883 (+) | 1356 | WP_011106800.1 | replicative DNA helicase | - |
| EGX80_RS08900 (EGX80_08915) | - | 1695876..1696637 (+) | 762 | WP_011054422.1 | conserved phage C-terminal domain-containing protein | - |
| EGX80_RS10285 (EGX80_08920) | - | 1696637..1697449 (+) | 813 | Protein_1670 | ATP-binding protein | - |
| EGX80_RS08910 (EGX80_08925) | - | 1697449..1697676 (+) | 228 | WP_011054424.1 | hypothetical protein | - |
| EGX80_RS08915 (EGX80_08930) | - | 1697690..1697896 (+) | 207 | WP_011054425.1 | hypothetical protein | - |
| EGX80_RS08920 (EGX80_08935) | - | 1697913..1698347 (+) | 435 | WP_011054426.1 | YopX family protein | - |
| EGX80_RS08925 (EGX80_08940) | - | 1698344..1698628 (+) | 285 | WP_011054427.1 | hypothetical protein | - |
| EGX80_RS08930 (EGX80_08945) | - | 1698630..1699262 (+) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| EGX80_RS08935 (EGX80_08950) | - | 1699267..1699779 (+) | 513 | WP_011054429.1 | DUF1642 domain-containing protein | - |
| EGX80_RS08940 (EGX80_08955) | - | 1699745..1699930 (+) | 186 | WP_011054430.1 | single-stranded DNA-binding protein | - |
| EGX80_RS08945 (EGX80_08960) | - | 1699945..1700226 (+) | 282 | WP_011054431.1 | hypothetical protein | - |
| EGX80_RS08950 (EGX80_08965) | - | 1700223..1700561 (+) | 339 | WP_011054432.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS08955 (EGX80_08970) | - | 1700563..1701390 (+) | 828 | WP_011054433.1 | prohibitin family protein | - |
| EGX80_RS08960 (EGX80_08975) | - | 1701405..1701806 (+) | 402 | WP_011017373.1 | hypothetical protein | - |
| EGX80_RS08965 (EGX80_08980) | - | 1701966..1702541 (+) | 576 | WP_011054435.1 | site-specific integrase | - |
| EGX80_RS08970 (EGX80_08985) | - | 1702695..1702988 (+) | 294 | WP_011017375.1 | hypothetical protein | - |
| EGX80_RS08975 (EGX80_08990) | - | 1703046..1703249 (+) | 204 | WP_011017376.1 | hypothetical protein | - |
| EGX80_RS08980 (EGX80_08995) | - | 1703275..1703661 (+) | 387 | WP_011017377.1 | hypothetical protein | - |
| EGX80_RS08985 (EGX80_09000) | - | 1703654..1703959 (+) | 306 | WP_011017378.1 | HNH endonuclease signature motif containing protein | - |
| EGX80_RS08990 (EGX80_09005) | - | 1704100..1704417 (+) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| EGX80_RS08995 (EGX80_09010) | - | 1704430..1706160 (+) | 1731 | WP_011017380.1 | terminase large subunit | - |
| EGX80_RS09000 (EGX80_09015) | - | 1706163..1706375 (+) | 213 | WP_136260634.1 | hypothetical protein | - |
| EGX80_RS09005 (EGX80_09020) | - | 1706528..1707715 (+) | 1188 | WP_011017381.1 | phage portal protein | - |
| EGX80_RS09010 (EGX80_09025) | - | 1707696..1708502 (+) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| EGX80_RS09015 (EGX80_09030) | - | 1708519..1709652 (+) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| EGX80_RS10110 | - | 1709666..1709839 (+) | 174 | WP_011017384.1 | hypothetical protein | - |
| EGX80_RS09020 (EGX80_09035) | - | 1709839..1710147 (+) | 309 | WP_011054437.1 | hypothetical protein | - |
| EGX80_RS09025 (EGX80_09040) | - | 1710140..1710502 (+) | 363 | WP_011017386.1 | hypothetical protein | - |
| EGX80_RS09030 (EGX80_09045) | - | 1710504..1710902 (+) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| EGX80_RS09035 (EGX80_09050) | - | 1710895..1711275 (+) | 381 | WP_011017388.1 | hypothetical protein | - |
| EGX80_RS09040 (EGX80_09055) | - | 1711287..1711871 (+) | 585 | WP_011017389.1 | major tail protein | - |
| EGX80_RS09045 (EGX80_09060) | - | 1711964..1712266 (+) | 303 | WP_011017390.1 | hypothetical protein | - |
| EGX80_RS09055 (EGX80_09070) | - | 1712492..1716592 (+) | 4101 | WP_011054439.1 | phage tail tape measure protein | - |
| EGX80_RS09060 (EGX80_09075) | - | 1716605..1717375 (+) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| EGX80_RS09065 (EGX80_09080) | - | 1717372..1719423 (+) | 2052 | WP_011054440.1 | phage tail spike protein | - |
| EGX80_RS09070 (EGX80_09085) | - | 1719420..1720397 (+) | 978 | Protein_1703 | hyaluronoglucosaminidase | - |
| EGX80_RS09075 (EGX80_09090) | - | 1720432..1722336 (+) | 1905 | WP_011054442.1 | gp58-like family protein | - |
| EGX80_RS09080 (EGX80_09095) | - | 1722348..1722776 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| EGX80_RS09085 (EGX80_09100) | - | 1722779..1723411 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| EGX80_RS09090 (EGX80_09105) | - | 1723423..1723695 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| EGX80_RS09095 (EGX80_09110) | - | 1723692..1723919 (+) | 228 | WP_011054444.1 | phage holin | - |
| EGX80_RS09100 (EGX80_09115) | - | 1724052..1725242 (+) | 1191 | WP_172586627.1 | glucosaminidase domain-containing protein | - |
| EGX80_RS09105 (EGX80_09120) | - | 1725380..1726504 (+) | 1125 | WP_011054547.1 | Fic family protein | - |
| EGX80_RS09110 (EGX80_09125) | entC3 | 1726717..1727499 (+) | 783 | WP_002988472.1 | enterotoxin type C3 EntC3 | - |
| EGX80_RS09115 (EGX80_09130) | prx | 1727612..1727800 (+) | 189 | WP_011054546.1 | hypothetical protein | Regulator |
| EGX80_RS09125 (EGX80_09140) | - | 1728391..1729005 (+) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| EGX80_RS09130 (EGX80_09145) | - | 1729136..1729921 (-) | 786 | WP_002984433.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7226.17 Da Isoelectric Point: 3.9947
>NTDB_id=326066 EGX80_RS09115 WP_011054546.1 1727612..1727800(+) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
MLTYDEFKQAIDDGYIVGDTVMIVRKNGQIFDYVLPHEEARNGEVVTEEKVEEVMVELDYIK
Nucleotide
Download Length: 189 bp
>NTDB_id=326066 EGX80_RS09115 WP_011054546.1 1727612..1727800(+) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGATGACGGATATATCGTAGGAGACACAGTTATGATCGTGCGTAAAAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAGGAAGCGAGAAATGGAGAAGTTGTGACAGAGGAGAAGGTGGAAGAAG
TGATGGTGGAATTAGACTATATCAAATGA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
95.161 |
0.806 |
| prx | Streptococcus pyogenes MGAS8232 |
84.483 |
93.548 |
0.79 |
| prx | Streptococcus pyogenes MGAS315 |
82.759 |
93.548 |
0.774 |
| prx | Streptococcus pyogenes MGAS315 |
77.966 |
95.161 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
66.129 |
0.581 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |