Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX80_RS02560 | Genome accession | NZ_CP033815 |
| Coordinates | 449260..449442 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054856.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain FDAARGOS_514 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 449260..490763 | 449260..449442 | within | 0 |
Gene organization within MGE regions
Location: 449260..490763
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX80_RS02560 (EGX80_02560) | prx | 449260..449442 (-) | 183 | WP_011054856.1 | hypothetical protein | Regulator |
| EGX80_RS02565 (EGX80_02565) | - | 449675..450661 (+) | 987 | WP_011106647.1 | DNA/RNA non-specific endonuclease | - |
| EGX80_RS02570 (EGX80_02570) | - | 450775..451290 (-) | 516 | WP_023077389.1 | hypothetical protein | - |
| EGX80_RS02575 (EGX80_02575) | - | 451612..452814 (-) | 1203 | WP_149031611.1 | glucosaminidase domain-containing protein | - |
| EGX80_RS02580 (EGX80_02580) | - | 452930..453157 (-) | 228 | WP_003058873.1 | phage holin | - |
| EGX80_RS02585 (EGX80_02585) | - | 453154..453426 (-) | 273 | WP_002986916.1 | hypothetical protein | - |
| EGX80_RS02590 (EGX80_02590) | - | 453436..454053 (-) | 618 | WP_011184056.1 | DUF1366 domain-containing protein | - |
| EGX80_RS02595 (EGX80_02595) | - | 454050..454487 (-) | 438 | WP_011106643.1 | DUF1617 family protein | - |
| EGX80_RS02600 (EGX80_02600) | - | 454499..456514 (-) | 2016 | WP_032461307.1 | gp58-like family protein | - |
| EGX80_RS02605 (EGX80_02605) | - | 456524..457530 (-) | 1007 | Protein_508 | hyaluronoglucosaminidase | - |
| EGX80_RS02610 (EGX80_02610) | - | 457527..459506 (-) | 1980 | WP_011054864.1 | phage tail protein | - |
| EGX80_RS02615 (EGX80_02615) | - | 459516..460358 (-) | 843 | WP_011054865.1 | phage tail family protein | - |
| EGX80_RS02620 (EGX80_02620) | - | 460370..464752 (-) | 4383 | WP_011054866.1 | tape measure protein | - |
| EGX80_RS02625 (EGX80_02625) | - | 464767..465000 (-) | 234 | WP_011054867.1 | hypothetical protein | - |
| EGX80_RS02630 (EGX80_02630) | - | 465075..465530 (-) | 456 | WP_011054868.1 | tail assembly chaperone | - |
| EGX80_RS02635 (EGX80_02635) | - | 465584..466183 (-) | 600 | WP_011054869.1 | phage major tail protein, TP901-1 family | - |
| EGX80_RS02640 (EGX80_02640) | - | 466195..466554 (-) | 360 | WP_011054870.1 | hypothetical protein | - |
| EGX80_RS02645 (EGX80_02645) | - | 466558..466902 (-) | 345 | WP_011106640.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EGX80_RS02650 (EGX80_02650) | - | 466899..467177 (-) | 279 | WP_011054872.1 | hypothetical protein | - |
| EGX80_RS02655 (EGX80_02655) | - | 467188..467544 (-) | 357 | WP_011054873.1 | phage head-tail connector protein | - |
| EGX80_RS02660 (EGX80_02660) | - | 467556..468443 (-) | 888 | WP_002983429.1 | hypothetical protein | - |
| EGX80_RS02665 (EGX80_02665) | - | 468456..469025 (-) | 570 | WP_149031612.1 | DUF4355 domain-containing protein | - |
| EGX80_RS02670 (EGX80_02670) | - | 469193..469459 (-) | 267 | WP_011054875.1 | hypothetical protein | - |
| EGX80_RS02675 (EGX80_02675) | - | 469464..469652 (-) | 189 | WP_011054876.1 | hypothetical protein | - |
| EGX80_RS02680 (EGX80_02680) | - | 469680..471128 (-) | 1449 | WP_011054877.1 | minor capsid protein | - |
| EGX80_RS02685 (EGX80_02685) | - | 471088..472620 (-) | 1533 | WP_011106638.1 | phage portal protein | - |
| EGX80_RS02690 (EGX80_02690) | - | 472636..473913 (-) | 1278 | WP_011054879.1 | PBSX family phage terminase large subunit | - |
| EGX80_RS02695 (EGX80_02695) | - | 473903..474355 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| EGX80_RS02700 (EGX80_02700) | - | 474445..474861 (-) | 417 | WP_011054881.1 | transcriptional regulator | - |
| EGX80_RS02705 (EGX80_02705) | - | 474994..475266 (-) | 273 | WP_011054882.1 | hypothetical protein | - |
| EGX80_RS10055 | - | 475259..475429 (-) | 171 | WP_011054883.1 | hypothetical protein | - |
| EGX80_RS02710 (EGX80_02710) | - | 475430..476752 (-) | 1323 | WP_149031613.1 | SNF2-related protein | - |
| EGX80_RS02715 (EGX80_02715) | - | 476749..477024 (-) | 276 | WP_011054885.1 | VRR-NUC domain-containing protein | - |
| EGX80_RS02720 (EGX80_02720) | - | 477390..479774 (-) | 2385 | WP_011054886.1 | phage/plasmid primase, P4 family | - |
| EGX80_RS02725 (EGX80_02725) | - | 479779..481701 (-) | 1923 | WP_011054887.1 | DNA polymerase | - |
| EGX80_RS02730 (EGX80_02730) | - | 481744..482307 (-) | 564 | WP_011054888.1 | DUF2815 family protein | - |
| EGX80_RS02735 (EGX80_02735) | - | 482321..483478 (-) | 1158 | WP_011054889.1 | DUF2800 domain-containing protein | - |
| EGX80_RS02740 (EGX80_02740) | - | 483478..483777 (-) | 300 | WP_000573833.1 | hypothetical protein | - |
| EGX80_RS02745 (EGX80_02745) | - | 483865..484068 (-) | 204 | WP_011054890.1 | hypothetical protein | - |
| EGX80_RS02750 (EGX80_02750) | - | 484214..484597 (-) | 384 | WP_011054892.1 | hypothetical protein | - |
| EGX80_RS02755 (EGX80_02755) | - | 484594..484801 (-) | 208 | Protein_539 | hypothetical protein | - |
| EGX80_RS02760 (EGX80_02760) | - | 484794..484964 (-) | 171 | WP_011054894.1 | hypothetical protein | - |
| EGX80_RS02765 (EGX80_02765) | - | 484993..485250 (-) | 258 | WP_011054895.1 | hypothetical protein | - |
| EGX80_RS02770 (EGX80_02770) | - | 485338..485538 (-) | 201 | WP_011184050.1 | hypothetical protein | - |
| EGX80_RS02775 (EGX80_02775) | - | 485589..485780 (-) | 192 | WP_001283052.1 | hypothetical protein | - |
| EGX80_RS02780 (EGX80_02780) | - | 486395..486769 (+) | 375 | WP_011054897.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS02785 (EGX80_02785) | - | 486783..487166 (+) | 384 | WP_011054898.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EGX80_RS02790 (EGX80_02790) | - | 487177..487728 (+) | 552 | WP_011054899.1 | hypothetical protein | - |
| EGX80_RS02795 (EGX80_02795) | - | 487904..488992 (+) | 1089 | WP_011054900.1 | site-specific integrase | - |
| EGX80_RS02800 (EGX80_02800) | - | 489135..490763 (-) | 1629 | WP_011054901.1 | ABC transporter permease | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6927.67 Da Isoelectric Point: 3.9286
>NTDB_id=326025 EGX80_RS02560 WP_011054856.1 449260..449442(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
MLTYDEFKQAIDDGYITGDTVAIVRKNGQIFDYALPNEEVRNGEVVTYENVEEVLRELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=326025 EGX80_RS02560 WP_011054856.1 449260..449442(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
ATGCTAACATACGATGAGTTTAAGCAAGCTATTGATGACGGATATATCACAGGCGACACAGTGGCGATCGTGCGCAAAAA
CGGACAGATTTTTGATTATGCGTTGCCGAATGAAGAGGTAAGAAATGGGGAGGTTGTAACATACGAAAATGTGGAAGAAG
TGCTGAGGGAATTAGACAAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
88.372 |
71.667 |
0.633 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
68.333 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |