Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX80_RS01975 | Genome accession | NZ_CP033815 |
| Coordinates | 351819..352001 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054793.1 | Uniprot ID | A0A5S4TJP1 |
| Organism | Streptococcus pyogenes strain FDAARGOS_514 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 351819..389787 | 351819..352001 | within | 0 |
Gene organization within MGE regions
Location: 351819..389787
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX80_RS01975 (EGX80_01975) | prx | 351819..352001 (-) | 183 | WP_011054793.1 | hypothetical protein | Regulator |
| EGX80_RS01980 (EGX80_01980) | speA | 352221..352976 (+) | 756 | WP_011054794.1 | streptococcal pyrogenic exotoxin SpeA | - |
| EGX80_RS01985 (EGX80_01985) | - | 353098..353757 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| EGX80_RS01990 (EGX80_01990) | - | 353757..353978 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| EGX80_RS01995 (EGX80_01995) | - | 353988..354761 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| EGX80_RS02000 (EGX80_02000) | - | 354772..355374 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| EGX80_RS02005 (EGX80_02005) | - | 355386..356150 (-) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| EGX80_RS02010 (EGX80_02010) | - | 356152..356484 (-) | 333 | WP_011054798.1 | phage holin | - |
| EGX80_RS10325 | - | 356820..356942 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| EGX80_RS02020 (EGX80_02020) | - | 356956..357303 (-) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| EGX80_RS02025 (EGX80_02025) | - | 357314..359176 (-) | 1863 | WP_011106671.1 | DUF859 family phage minor structural protein | - |
| EGX80_RS02030 (EGX80_02030) | - | 359181..362621 (-) | 3441 | WP_011054801.1 | glucosaminidase domain-containing protein | - |
| EGX80_RS02035 (EGX80_02035) | - | 362622..364106 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| EGX80_RS02040 (EGX80_02040) | - | 364107..365912 (-) | 1806 | WP_011054802.1 | tail protein | - |
| EGX80_RS02045 (EGX80_02045) | - | 365905..366363 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| EGX80_RS02050 (EGX80_02050) | - | 366336..366653 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| EGX80_RS02055 (EGX80_02055) | - | 366666..367172 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| EGX80_RS02060 (EGX80_02060) | - | 367184..367594 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| EGX80_RS02065 (EGX80_02065) | - | 367596..367991 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| EGX80_RS02070 (EGX80_02070) | - | 367988..368299 (-) | 312 | WP_009880258.1 | hypothetical protein | - |
| EGX80_RS02075 (EGX80_02075) | - | 368296..368640 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| EGX80_RS02080 (EGX80_02080) | - | 368654..368947 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| EGX80_RS02085 (EGX80_02085) | - | 368960..369850 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| EGX80_RS02090 (EGX80_02090) | - | 369868..370440 (-) | 573 | WP_011054804.1 | DUF4355 domain-containing protein | - |
| EGX80_RS02095 (EGX80_02095) | - | 370590..370856 (-) | 267 | WP_011054805.1 | hypothetical protein | - |
| EGX80_RS02100 (EGX80_02100) | - | 370863..371771 (-) | 909 | WP_009880264.1 | minor capsid protein | - |
| EGX80_RS02105 (EGX80_02105) | - | 371740..373065 (-) | 1326 | WP_032461413.1 | phage portal protein | - |
| EGX80_RS02110 (EGX80_02110) | - | 373065..374339 (-) | 1275 | Protein_419 | PBSX family phage terminase large subunit | - |
| EGX80_RS02115 (EGX80_02115) | - | 374329..374709 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| EGX80_RS02120 (EGX80_02120) | - | 375319..375753 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EGX80_RS10030 | - | 376037..376207 (-) | 171 | WP_002987493.1 | hypothetical protein | - |
| EGX80_RS02125 (EGX80_02125) | - | 376204..376707 (-) | 504 | WP_011054811.1 | DUF1642 domain-containing protein | - |
| EGX80_RS02130 (EGX80_02130) | - | 376994..377179 (-) | 186 | WP_011054812.1 | hypothetical protein | - |
| EGX80_RS02135 (EGX80_02135) | - | 377345..377680 (-) | 336 | WP_011054813.1 | hypothetical protein | - |
| EGX80_RS02140 (EGX80_02140) | - | 377683..377967 (-) | 285 | WP_032461310.1 | hypothetical protein | - |
| EGX80_RS10035 | - | 377964..378134 (-) | 171 | WP_011054814.1 | hypothetical protein | - |
| EGX80_RS02145 (EGX80_02145) | - | 378131..378544 (-) | 414 | WP_011054815.1 | YopX family protein | - |
| EGX80_RS02150 (EGX80_02150) | - | 378541..378825 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| EGX80_RS10365 (EGX80_02155) | - | 378819..379070 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| EGX80_RS02160 (EGX80_02160) | - | 379067..379423 (-) | 357 | WP_011054816.1 | hypothetical protein | - |
| EGX80_RS02165 (EGX80_02165) | - | 379407..379727 (-) | 321 | WP_011054817.1 | VRR-NUC domain-containing protein | - |
| EGX80_RS02170 (EGX80_02170) | - | 379972..381452 (-) | 1481 | Protein_433 | phage/plasmid primase, P4 family | - |
| EGX80_RS02175 (EGX80_02175) | - | 381442..382254 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| EGX80_RS02180 (EGX80_02180) | - | 382257..382715 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| EGX80_RS02185 (EGX80_02185) | - | 382731..383960 (-) | 1230 | WP_011054819.1 | DEAD/DEAH box helicase | - |
| EGX80_RS02190 (EGX80_02190) | - | 384062..384742 (-) | 681 | WP_002995975.1 | AAA family ATPase | - |
| EGX80_RS02195 (EGX80_02195) | - | 384743..385225 (-) | 483 | WP_011054820.1 | siphovirus Gp157 family protein | - |
| EGX80_RS02200 (EGX80_02200) | - | 385454..385768 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS10040 | - | 385784..385921 (-) | 138 | WP_011054821.1 | hypothetical protein | - |
| EGX80_RS02205 (EGX80_02205) | - | 385952..386203 (-) | 252 | WP_011054822.1 | hypothetical protein | - |
| EGX80_RS02210 (EGX80_02210) | - | 386298..386516 (-) | 219 | WP_009881062.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS02215 (EGX80_02215) | - | 386705..387064 (+) | 360 | WP_032461558.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS02220 (EGX80_02220) | - | 387048..387425 (+) | 378 | WP_032461557.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EGX80_RS10045 | - | 387436..387588 (+) | 153 | WP_011054825.1 | hypothetical protein | - |
| EGX80_RS02225 (EGX80_02225) | - | 387857..388447 (+) | 591 | WP_009880743.1 | hypothetical protein | - |
| EGX80_RS02230 (EGX80_02230) | - | 388621..389787 (+) | 1167 | WP_009880742.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 7014.08 Da Isoelectric Point: 4.3313
>NTDB_id=326021 EGX80_RS01975 WP_011054793.1 351819..352001(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=326021 EGX80_RS01975 WP_011054793.1 351819..352001(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAGGGGTATATTTTAGGTGACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTACCACACGAAAAAGTGAGAGATGATGAAGTTGTGACGGTAGAGAGAGTGGAAGAAG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
100 |
0.767 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS8232 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
68.333 |
100 |
0.683 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
70 |
0.533 |