Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX80_RS00925 | Genome accession | NZ_CP033815 |
| Coordinates | 176283..176465 (-) | Length | 60 a.a. |
| NCBI ID | WP_011054671.1 | Uniprot ID | Q4VUT1 |
| Organism | Streptococcus pyogenes strain FDAARGOS_514 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 176283..216113 | 176283..176465 | within | 0 |
Gene organization within MGE regions
Location: 176283..216113
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX80_RS00925 (EGX80_00925) | prx | 176283..176465 (-) | 183 | WP_011054671.1 | hypothetical protein | Regulator |
| EGX80_RS00930 (EGX80_00930) | - | 176532..177326 (-) | 795 | WP_002983479.1 | DNA/RNA non-specific endonuclease | - |
| EGX80_RS00935 (EGX80_00935) | - | 177571..178785 (-) | 1215 | WP_002983477.1 | peptidoglycan amidohydrolase family protein | - |
| EGX80_RS00940 (EGX80_00940) | - | 178897..179352 (-) | 456 | WP_002983475.1 | phage holin family protein | - |
| EGX80_RS00945 (EGX80_00945) | - | 179363..179977 (-) | 615 | WP_011054672.1 | DUF1366 domain-containing protein | - |
| EGX80_RS00950 (EGX80_00950) | - | 179980..180411 (-) | 432 | WP_011054673.1 | DUF1617 family protein | - |
| EGX80_RS00955 (EGX80_00955) | - | 180420..182201 (-) | 1782 | WP_011054674.1 | gp58-like family protein | - |
| EGX80_RS00960 (EGX80_00960) | - | 182216..183325 (-) | 1110 | WP_011054675.1 | hyaluronoglucosaminidase | - |
| EGX80_RS00965 (EGX80_00965) | - | 183325..185298 (-) | 1974 | WP_032461270.1 | phage tail spike protein | - |
| EGX80_RS00970 (EGX80_00970) | - | 185280..185975 (-) | 696 | WP_002992579.1 | hypothetical protein | - |
| EGX80_RS00975 (EGX80_00975) | - | 185972..188335 (-) | 2364 | WP_011054677.1 | hypothetical protein | - |
| EGX80_RS00980 (EGX80_00980) | - | 188335..188706 (-) | 372 | WP_011054678.1 | DUF5361 domain-containing protein | - |
| EGX80_RS00985 (EGX80_00985) | - | 188721..188984 (-) | 264 | WP_010922455.1 | hypothetical protein | - |
| EGX80_RS00990 (EGX80_00990) | - | 188995..189585 (-) | 591 | WP_011054679.1 | hypothetical protein | - |
| EGX80_RS00995 (EGX80_00995) | - | 189601..189936 (-) | 336 | WP_000573598.1 | hypothetical protein | - |
| EGX80_RS01000 (EGX80_01000) | - | 189937..190173 (-) | 237 | WP_000032787.1 | hypothetical protein | - |
| EGX80_RS01005 (EGX80_01005) | - | 190166..190504 (-) | 339 | WP_011054681.1 | hypothetical protein | - |
| EGX80_RS01010 (EGX80_01010) | - | 190464..190886 (-) | 423 | WP_011054682.1 | phage Gp19/Gp15/Gp42 family protein | - |
| EGX80_RS01015 (EGX80_01015) | - | 190896..191096 (-) | 201 | WP_010922460.1 | hypothetical protein | - |
| EGX80_RS01020 (EGX80_01020) | - | 191096..192007 (-) | 912 | WP_011054683.1 | phage major capsid protein | - |
| EGX80_RS01025 (EGX80_01025) | - | 192032..192493 (-) | 462 | WP_011054684.1 | DUF4355 domain-containing protein | - |
| EGX80_RS01030 (EGX80_01030) | - | 192574..193989 (-) | 1416 | WP_011054685.1 | terminase | - |
| EGX80_RS01035 (EGX80_01035) | - | 194071..194286 (-) | 216 | WP_011106704.1 | hypothetical protein | - |
| EGX80_RS01040 (EGX80_01040) | - | 194288..194554 (-) | 267 | WP_002986828.1 | hypothetical protein | - |
| EGX80_RS10000 | - | 194547..194699 (-) | 153 | WP_011054687.1 | hypothetical protein | - |
| EGX80_RS01045 (EGX80_01045) | - | 194776..195000 (-) | 225 | WP_002994100.1 | hypothetical protein | - |
| EGX80_RS01050 (EGX80_01050) | - | 195006..196499 (-) | 1494 | WP_010922467.1 | hypothetical protein | - |
| EGX80_RS01055 (EGX80_01055) | - | 196492..197760 (-) | 1269 | WP_010922468.1 | phage portal protein | - |
| EGX80_RS01060 (EGX80_01060) | - | 197757..198113 (-) | 357 | WP_002994106.1 | hypothetical protein | - |
| EGX80_RS01065 (EGX80_01065) | - | 198261..198605 (-) | 345 | WP_011054690.1 | HNH endonuclease signature motif containing protein | - |
| EGX80_RS01070 (EGX80_01070) | - | 198713..199132 (-) | 420 | WP_011054691.1 | DUF1492 domain-containing protein | - |
| EGX80_RS01075 (EGX80_01075) | - | 199208..199459 (-) | 252 | WP_011054692.1 | hypothetical protein | - |
| EGX80_RS10005 | - | 199456..199611 (-) | 156 | WP_011054693.1 | hypothetical protein | - |
| EGX80_RS01080 (EGX80_01080) | - | 199608..199925 (-) | 318 | WP_011054694.1 | DUF1372 family protein | - |
| EGX80_RS01085 (EGX80_01085) | - | 199961..200473 (-) | 513 | WP_011054695.1 | hypothetical protein | - |
| EGX80_RS01090 (EGX80_01090) | - | 200470..200802 (-) | 333 | WP_011054696.1 | hypothetical protein | - |
| EGX80_RS01095 (EGX80_01095) | - | 200813..202159 (-) | 1347 | WP_011054697.1 | PcfJ domain-containing protein | - |
| EGX80_RS01100 (EGX80_01100) | - | 202156..202551 (-) | 396 | WP_011054698.1 | Cas9 inhibitor AcrIIA9 family protein | - |
| EGX80_RS01105 (EGX80_01105) | - | 202916..203713 (-) | 798 | WP_011054699.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
| EGX80_RS01110 (EGX80_01110) | - | 203706..203906 (-) | 201 | WP_000594115.1 | hypothetical protein | - |
| EGX80_RS01115 (EGX80_01115) | - | 203903..204829 (-) | 927 | WP_011054700.1 | recombinase RecT | - |
| EGX80_RS01120 (EGX80_01120) | - | 204832..205162 (-) | 331 | Protein_223 | hypothetical protein | - |
| EGX80_RS01125 (EGX80_01125) | - | 205218..205424 (-) | 207 | WP_002988357.1 | hypothetical protein | - |
| EGX80_RS01130 (EGX80_01130) | - | 205433..205573 (-) | 141 | WP_002988354.1 | hypothetical protein | - |
| EGX80_RS01135 (EGX80_01135) | - | 205570..205803 (-) | 234 | WP_010922205.1 | hypothetical protein | - |
| EGX80_RS01140 (EGX80_01140) | - | 205784..206170 (-) | 387 | WP_011017564.1 | DnaD domain-containing protein | - |
| EGX80_RS10170 (EGX80_01145) | - | 206311..206580 (-) | 270 | WP_011106700.1 | replication protein | - |
| EGX80_RS01150 (EGX80_01150) | - | 206674..206859 (-) | 186 | WP_010922477.1 | hypothetical protein | - |
| EGX80_RS01155 (EGX80_01155) | - | 206861..207172 (-) | 312 | WP_010922478.1 | excisionase | - |
| EGX80_RS01160 (EGX80_01160) | - | 207442..207654 (-) | 213 | WP_010922479.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS01165 (EGX80_01165) | - | 207855..208610 (+) | 756 | WP_010922480.1 | XRE family transcriptional regulator | - |
| EGX80_RS01170 (EGX80_01170) | - | 208622..209140 (+) | 519 | WP_010922481.1 | HIRAN domain-containing protein | - |
| EGX80_RS01175 (EGX80_01175) | - | 209264..210406 (+) | 1143 | WP_003051793.1 | site-specific integrase | - |
| EGX80_RS01180 (EGX80_01180) | - | 210495..210770 (-) | 276 | WP_002983920.1 | HU family DNA-binding protein | - |
| EGX80_RS01185 (EGX80_01185) | - | 210869..211456 (-) | 588 | WP_002989129.1 | YpmS family protein | - |
| EGX80_RS01190 (EGX80_01190) | - | 211434..212276 (-) | 843 | WP_002992620.1 | SGNH/GDSL hydrolase family protein | - |
| EGX80_RS01195 (EGX80_01195) | - | 212269..213108 (-) | 840 | WP_011054703.1 | DegV family protein | - |
| EGX80_RS01200 (EGX80_01200) | - | 213336..214280 (-) | 945 | WP_011054704.1 | LPXTG cell wall anchor domain-containing protein | - |
| EGX80_RS01205 (EGX80_01205) | recN | 214452..216113 (-) | 1662 | WP_002983909.1 | DNA repair protein RecN | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6978.99 Da Isoelectric Point: 4.3466
>NTDB_id=326016 EGX80_RS00925 WP_011054671.1 176283..176465(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
MLTYDEFKQAIDRGYITADTVMIVRKNGQIFDYVLPNEKIKNGEIVTDEKVEEVLVELSR
Nucleotide
Download Length: 183 bp
>NTDB_id=326016 EGX80_RS00925 WP_011054671.1 176283..176465(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
ATGCTAACATACGACGAATTTAAGCAAGCTATTGACCGTGGATATATCACAGCAGACACAGTAATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGAATGAGAAGATAAAGAATGGAGAAATTGTGACAGACGAAAAAGTGGAAGAGG
TGCTGGTGGAGCTTTCGAGATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS8232 |
85 |
100 |
0.85 |
| prx | Streptococcus pyogenes MGAS315 |
78.333 |
100 |
0.783 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
83.721 |
71.667 |
0.6 |
| prx | Streptococcus pyogenes MGAS315 |
82.927 |
68.333 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
71.429 |
70 |
0.5 |