Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX80_RS00085 | Genome accession | NZ_CP033815 |
| Coordinates | 16075..16257 (-) | Length | 60 a.a. |
| NCBI ID | WP_029714017.1 | Uniprot ID | A0A5S4TLJ0 |
| Organism | Streptococcus pyogenes strain FDAARGOS_514 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 16075..61850 | 16075..16257 | within | 0 |
Gene organization within MGE regions
Location: 16075..61850
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX80_RS00085 (EGX80_00085) | prx | 16075..16257 (-) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| EGX80_RS00090 (EGX80_00090) | - | 16456..16665 (-) | 210 | WP_011054450.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS09980 | - | 16819..16965 (+) | 147 | WP_011054449.1 | hypothetical protein | - |
| EGX80_RS00095 (EGX80_00095) | - | 17106..17357 (+) | 252 | WP_011054448.1 | hypothetical protein | - |
| EGX80_RS00100 (EGX80_00100) | - | 17621..17860 (+) | 240 | WP_011054447.1 | hypothetical protein | - |
| EGX80_RS00105 (EGX80_00105) | - | 17918..18274 (+) | 357 | WP_011054446.1 | hypothetical protein | - |
| EGX80_RS00110 (EGX80_00110) | - | 18390..19598 (-) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| EGX80_RS00115 (EGX80_00115) | - | 19714..19941 (-) | 228 | WP_011054444.1 | phage holin | - |
| EGX80_RS00120 (EGX80_00120) | - | 19938..20213 (-) | 276 | WP_002987582.1 | hypothetical protein | - |
| EGX80_RS00125 (EGX80_00125) | - | 20223..20840 (-) | 618 | WP_010922094.1 | DUF1366 domain-containing protein | - |
| EGX80_RS00130 (EGX80_00130) | - | 20843..21274 (-) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| EGX80_RS00135 (EGX80_00135) | - | 21286..23304 (-) | 2019 | WP_011106754.1 | gp58-like family protein | - |
| EGX80_RS00140 (EGX80_00140) | - | 23314..24423 (-) | 1110 | WP_023609821.1 | hyaluronidase HylP | - |
| EGX80_RS00145 (EGX80_00145) | - | 24423..26570 (-) | 2148 | WP_023605202.1 | phage tail spike protein | - |
| EGX80_RS00150 (EGX80_00150) | - | 26567..27274 (-) | 708 | WP_011054553.1 | distal tail protein Dit | - |
| EGX80_RS00155 (EGX80_00155) | - | 27274..31197 (-) | 3924 | WP_011054554.1 | phage tail tape measure protein | - |
| EGX80_RS09985 | - | 31210..31359 (-) | 150 | WP_023609816.1 | hypothetical protein | - |
| EGX80_RS00160 (EGX80_00160) | - | 31407..31733 (-) | 327 | WP_011054556.1 | hypothetical protein | - |
| EGX80_RS00165 (EGX80_00165) | - | 31786..32397 (-) | 612 | WP_011054557.1 | major tail protein | - |
| EGX80_RS00170 (EGX80_00170) | - | 32416..32841 (-) | 426 | WP_011054558.1 | hypothetical protein | - |
| EGX80_RS00175 (EGX80_00175) | - | 32838..33215 (-) | 378 | WP_011054559.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EGX80_RS00180 (EGX80_00180) | - | 33212..33550 (-) | 339 | WP_011054560.1 | phage head closure protein | - |
| EGX80_RS00185 (EGX80_00185) | - | 33547..33849 (-) | 303 | WP_011054561.1 | head-tail connector protein | - |
| EGX80_RS10295 | - | 33852..33980 (-) | 129 | WP_011054562.1 | hypothetical protein | - |
| EGX80_RS00190 (EGX80_00190) | - | 33994..35178 (-) | 1185 | WP_011054563.1 | phage major capsid protein | - |
| EGX80_RS00195 (EGX80_00195) | - | 35204..35869 (-) | 666 | WP_011054564.1 | head maturation protease, ClpP-related | - |
| EGX80_RS00200 (EGX80_00200) | - | 35847..37067 (-) | 1221 | WP_011054565.1 | phage portal protein | - |
| EGX80_RS00205 (EGX80_00205) | - | 37101..37367 (-) | 267 | WP_011054566.1 | hypothetical protein | - |
| EGX80_RS09990 | - | 37360..37530 (-) | 171 | WP_011054567.1 | hypothetical protein | - |
| EGX80_RS00210 (EGX80_00210) | - | 37527..39281 (-) | 1755 | WP_011054568.1 | terminase TerL endonuclease subunit | - |
| EGX80_RS00215 (EGX80_00215) | - | 39296..39763 (-) | 468 | WP_011054569.1 | phage terminase small subunit P27 family | - |
| EGX80_RS00220 (EGX80_00220) | - | 39935..40273 (-) | 339 | WP_002985375.1 | HNH endonuclease signature motif containing protein | - |
| EGX80_RS00230 (EGX80_00230) | - | 40859..41299 (-) | 441 | WP_011054571.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EGX80_RS00240 (EGX80_00240) | - | 41572..42207 (-) | 636 | WP_011054572.1 | N-6 DNA methylase | - |
| EGX80_RS00245 (EGX80_00245) | - | 42207..42608 (-) | 402 | WP_011054573.1 | hypothetical protein | - |
| EGX80_RS00250 (EGX80_00250) | - | 42799..43196 (-) | 398 | Protein_50 | SAM-dependent methyltransferase | - |
| EGX80_RS00255 (EGX80_00255) | - | 43198..43482 (-) | 285 | WP_011106747.1 | hypothetical protein | - |
| EGX80_RS00260 (EGX80_00260) | - | 43479..43682 (-) | 204 | WP_011054575.1 | hypothetical protein | - |
| EGX80_RS00265 (EGX80_00265) | - | 43666..43986 (-) | 321 | WP_011054576.1 | VRR-NUC domain-containing protein | - |
| EGX80_RS00270 (EGX80_00270) | - | 43983..44396 (-) | 414 | WP_008087509.1 | hypothetical protein | - |
| EGX80_RS00275 (EGX80_00275) | - | 44658..46131 (-) | 1474 | Protein_55 | phage/plasmid primase, P4 family | - |
| EGX80_RS00280 (EGX80_00280) | - | 46121..46933 (-) | 813 | WP_011106664.1 | bifunctional DNA primase/polymerase | - |
| EGX80_RS00285 (EGX80_00285) | - | 46936..47394 (-) | 459 | WP_011054580.1 | DUF669 domain-containing protein | - |
| EGX80_RS00290 (EGX80_00290) | - | 47548..48498 (-) | 951 | WP_363128943.1 | helicase-related protein | - |
| EGX80_RS00295 (EGX80_00295) | - | 48737..49414 (-) | 678 | Protein_59 | AAA family ATPase | - |
| EGX80_RS10305 (EGX80_00300) | - | 49527..49894 (-) | 368 | Protein_60 | siphovirus Gp157 family protein | - |
| EGX80_RS00305 (EGX80_00305) | - | 50123..50437 (-) | 315 | WP_011054583.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS10310 | - | 50453..50587 (-) | 135 | WP_002995985.1 | hypothetical protein | - |
| EGX80_RS00310 (EGX80_00310) | - | 50584..50880 (-) | 297 | WP_011054584.1 | MerR family transcriptional regulator | - |
| EGX80_RS00315 (EGX80_00315) | - | 50958..51143 (-) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS00320 (EGX80_00320) | - | 51310..51549 (+) | 240 | WP_011054586.1 | hypothetical protein | - |
| EGX80_RS00325 (EGX80_00325) | - | 51700..51909 (+) | 210 | WP_002984292.1 | hypothetical protein | - |
| EGX80_RS00335 (EGX80_00335) | - | 52125..52364 (-) | 240 | WP_011054588.1 | helix-turn-helix transcriptional regulator | - |
| EGX80_RS00340 (EGX80_00340) | - | 52438..52824 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| EGX80_RS00345 (EGX80_00345) | - | 52813..53019 (-) | 207 | WP_011054590.1 | hypothetical protein | - |
| EGX80_RS00350 (EGX80_00350) | - | 53076..53855 (+) | 780 | WP_011054591.1 | hypothetical protein | - |
| EGX80_RS00355 (EGX80_00355) | - | 53989..54135 (-) | 147 | WP_011054593.1 | hypothetical protein | - |
| EGX80_RS00360 (EGX80_00360) | - | 54507..55295 (+) | 789 | WP_021340822.1 | S24 family peptidase | - |
| EGX80_RS00365 (EGX80_00365) | - | 55305..55610 (+) | 306 | WP_011106738.1 | membrane protein | - |
| EGX80_RS00370 (EGX80_00370) | - | 55730..56818 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| EGX80_RS00375 (EGX80_00375) | - | 57181..57801 (+) | 621 | WP_011054596.1 | DUF3862 domain-containing protein | - |
| EGX80_RS00380 (EGX80_00380) | glgP | 58058..60322 (-) | 2265 | WP_011054597.1 | glycogen/starch/alpha-glucan family phosphorylase | - |
| EGX80_RS00385 (EGX80_00385) | malQ | 60357..61850 (-) | 1494 | WP_002984251.1 | 4-alpha-glucanotransferase | - |
Sequence
Protein
Download Length: 60 a.a. Molecular weight: 6890.90 Da Isoelectric Point: 4.1947
>NTDB_id=326013 EGX80_RS00085 WP_029714017.1 16075..16257(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
MLTYDEFKQAIDNGYITADTVAIVRKNGLIFDYVLPHESVRSCEIVIEERVAEVMVELDK
Nucleotide
Download Length: 183 bp
>NTDB_id=326013 EGX80_RS00085 WP_029714017.1 16075..16257(-) (prx) [Streptococcus pyogenes strain FDAARGOS_514]
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
ATGCTAACATACGACGAGTTTAAGCAAGCGATTGACAATGGATATATCACAGCAGACACAGTAGCGATCGTGCGTAAAAA
CGGATTGATATTTGATTATGTGTTGCCGCACGAGTCTGTGAGATCGTGTGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGATGGTGGAATTAGACAAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
100 |
100 |
1 |
| prx | Streptococcus pyogenes MGAS315 |
80 |
100 |
0.8 |
| prx | Streptococcus pyogenes MGAS315 |
75 |
100 |
0.75 |
| prx | Streptococcus pyogenes MGAS315 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS8232 |
73.333 |
100 |
0.733 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
70 |
0.567 |
| prx | Streptococcus pyogenes MGAS315 |
78.571 |
70 |
0.55 |