Detailed information    

insolico Bioinformatically predicted

Overview

Name   prx   Type   Regulator
Locus tag   EGX72_RS08865 Genome accession   NZ_CP033809
Coordinates   1684851..1685030 (-) Length   59 a.a.
NCBI ID   WP_000965642.1    Uniprot ID   A0AAW6XV58
Organism   Streptococcus sp. FDAARGOS_521     
Function   Inhibit ComR activation (predicted from homology)   
Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1670455..1727175 1684851..1685030 within 0


Gene organization within MGE regions


Location: 1670455..1727175
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  EGX72_RS08775 (EGX72_08765) gyrB 1670455..1672407 (-) 1953 WP_000134196.1 DNA topoisomerase (ATP-hydrolyzing) subunit B -
  EGX72_RS08780 (EGX72_08770) - 1672408..1672968 (-) 561 WP_001106189.1 HAD-IA family hydrolase -
  EGX72_RS08785 (EGX72_08775) - 1673087..1674292 (-) 1206 WP_123947966.1 FtsW/RodA/SpoVE family cell cycle protein -
  EGX72_RS08790 (EGX72_08780) prx 1674717..1674905 (-) 189 WP_000027835.1 hypothetical protein Regulator
  EGX72_RS08795 (EGX72_08785) - 1674947..1675147 (-) 201 WP_000076708.1 CsbD family protein -
  EGX72_RS08800 (EGX72_08790) - 1675325..1675972 (+) 648 Protein_1640 IS3 family transposase -
  EGX72_RS08805 (EGX72_08795) - 1676024..1677343 (-) 1320 WP_000734169.1 HAMP domain-containing sensor histidine kinase -
  EGX72_RS08810 (EGX72_08800) - 1677340..1677993 (-) 654 WP_000699093.1 response regulator transcription factor -
  EGX72_RS08815 (EGX72_08805) - 1678090..1679466 (-) 1377 WP_123947968.1 ABC transporter permease -
  EGX72_RS08820 (EGX72_08810) - 1679466..1680122 (-) 657 WP_000353149.1 ABC transporter ATP-binding protein -
  EGX72_RS08825 (EGX72_08815) - 1680132..1681409 (-) 1278 WP_000594360.1 ABC transporter permease -
  EGX72_RS08830 (EGX72_08820) - 1682151..1682312 (+) 162 WP_000508795.1 TM2 domain-containing protein -
  EGX72_RS11715 - 1682485..1683847 (-) 1363 Protein_1647 IS3 family transposase -
  EGX72_RS08855 (EGX72_08845) - 1683868..1684134 (+) 267 WP_001872365.1 hypothetical protein -
  EGX72_RS11720 - 1684170..1684433 (+) 264 WP_253257034.1 tyrosine-type recombinase/integrase -
  EGX72_RS08865 (EGX72_08855) prx 1684851..1685030 (-) 180 WP_000965642.1 hypothetical protein Regulator
  EGX72_RS11760 - 1685186..1685311 (+) 126 WP_301182291.1 hypothetical protein -
  EGX72_RS08870 (EGX72_08860) - 1685447..1685617 (+) 171 WP_000356856.1 hypothetical protein -
  EGX72_RS08875 (EGX72_08865) - 1685658..1685858 (-) 201 WP_000076715.1 CsbD family protein -
  EGX72_RS08880 (EGX72_08870) - 1685962..1686933 (-) 972 WP_000812952.1 Abi family protein -
  EGX72_RS08885 (EGX72_08875) - 1687266..1687985 (-) 720 WP_000236381.1 peptidoglycan amidohydrolase family protein -
  EGX72_RS08890 (EGX72_08880) - 1687987..1688322 (-) 336 WP_001001742.1 phage holin -
  EGX72_RS08895 (EGX72_08885) - 1688324..1688624 (-) 301 Protein_1657 hypothetical protein -
  EGX72_RS08900 (EGX72_08890) - 1688637..1688844 (-) 208 Protein_1658 hypothetical protein -
  EGX72_RS08905 (EGX72_08895) - 1688819..1689145 (-) 327 Protein_1659 hypothetical protein -
  EGX72_RS08910 (EGX72_08900) - 1689171..1691167 (-) 1997 Protein_1660 DUF859 family phage minor structural protein -
  EGX72_RS08915 (EGX72_08905) - 1691178..1695295 (-) 4118 Protein_1661 glucosaminidase domain-containing protein -
  EGX72_RS08920 (EGX72_08910) - 1695296..1696816 (-) 1521 WP_000228810.1 distal tail protein Dit -
  EGX72_RS08925 (EGX72_08915) - 1696810..1698822 (-) 2013 WP_000224695.1 hypothetical protein -
  EGX72_RS08930 (EGX72_08920) - 1698822..1699193 (-) 372 WP_000916438.1 DUF5361 domain-containing protein -
  EGX72_RS08935 (EGX72_08925) - 1699208..1699453 (-) 246 WP_000858406.1 hypothetical protein -
  EGX72_RS08940 (EGX72_08930) - 1699453..1700010 (-) 558 WP_000226354.1 tail protein -
  EGX72_RS08945 (EGX72_08935) - 1700020..1700355 (-) 336 WP_000573598.1 hypothetical protein -
  EGX72_RS08950 (EGX72_08940) - 1700356..1700592 (-) 237 WP_000032787.1 hypothetical protein -
  EGX72_RS08955 (EGX72_08945) - 1700585..1700923 (-) 339 WP_000517229.1 hypothetical protein -
  EGX72_RS08960 (EGX72_08950) - 1700874..1701305 (-) 432 WP_000180800.1 phage Gp19/Gp15/Gp42 family protein -
  EGX72_RS08965 (EGX72_08955) - 1701319..1701534 (-) 216 WP_000640307.1 hypothetical protein -
  EGX72_RS08970 (EGX72_08960) - 1701531..1702433 (-) 903 WP_000841023.1 phage major capsid protein -
  EGX72_RS08975 (EGX72_08965) - 1702436..1702900 (-) 465 WP_001288694.1 DUF4355 domain-containing protein -
  EGX72_RS08980 (EGX72_08970) - 1702981..1704396 (-) 1416 WP_000256853.1 terminase large subunit -
  EGX72_RS08985 (EGX72_08975) - 1704504..1704692 (-) 189 WP_000421991.1 hypothetical protein -
  EGX72_RS08990 (EGX72_08980) - 1704692..1705912 (-) 1221 WP_000227333.1 polymorphic toxin type 50 domain-containing protein -
  EGX72_RS08995 (EGX72_08985) - 1705905..1707173 (-) 1269 WP_001108668.1 phage portal protein -
  EGX72_RS09000 (EGX72_08990) - 1707170..1707526 (-) 357 WP_000725957.1 hypothetical protein -
  EGX72_RS09005 (EGX72_08995) - 1707678..1708055 (-) 378 WP_017646473.1 HNH endonuclease -
  EGX72_RS09010 (EGX72_09000) - 1708638..1709063 (-) 426 WP_000533373.1 DUF1492 domain-containing protein -
  EGX72_RS09015 (EGX72_09005) - 1709454..1709759 (-) 306 WP_123957764.1 hypothetical protein -
  EGX72_RS09020 (EGX72_09010) - 1709716..1710249 (-) 534 WP_001019148.1 DUF1642 domain-containing protein -
  EGX72_RS11765 (EGX72_09015) - 1710342..1710473 (-) 132 WP_011058321.1 hypothetical protein -
  EGX72_RS09030 (EGX72_09020) - 1710556..1710888 (-) 333 WP_000052302.1 hypothetical protein -
  EGX72_RS09035 (EGX72_09025) - 1710891..1711160 (-) 270 WP_000139629.1 hypothetical protein -
  EGX72_RS09040 (EGX72_09030) - 1711157..1711321 (-) 165 WP_000159369.1 hypothetical protein -
  EGX72_RS09045 (EGX72_09035) - 1711318..1711734 (-) 417 WP_000612734.1 YopX family protein -
  EGX72_RS09055 (EGX72_09045) - 1711869..1712171 (-) 303 WP_000763909.1 nucleotide modification associated domain-containing protein -
  EGX72_RS09060 (EGX72_09050) - 1712183..1712530 (-) 348 WP_000129030.1 hypothetical protein -
  EGX72_RS09065 (EGX72_09055) - 1712520..1712996 (-) 477 WP_000143298.1 RusA family crossover junction endodeoxyribonuclease -
  EGX72_RS09070 (EGX72_09060) - 1712986..1713189 (-) 204 WP_000165747.1 hypothetical protein -
  EGX72_RS09075 (EGX72_09065) ssb 1713193..1713609 (-) 417 WP_000609377.1 single-stranded DNA-binding protein Machinery gene
  EGX72_RS09080 (EGX72_09070) - 1713602..1714276 (-) 675 WP_001231960.1 ERF family protein -
  EGX72_RS09085 (EGX72_09075) - 1714277..1714759 (-) 483 WP_000323859.1 siphovirus Gp157 family protein -
  EGX72_RS09090 (EGX72_09080) - 1714761..1714922 (-) 162 WP_001001351.1 hypothetical protein -
  EGX72_RS09095 (EGX72_09085) - 1714925..1715179 (-) 255 WP_000229417.1 hypothetical protein -
  EGX72_RS09100 (EGX72_09090) - 1715190..1715330 (-) 141 WP_000166038.1 hypothetical protein -
  EGX72_RS09105 (EGX72_09095) - 1715327..1715560 (-) 234 WP_123957765.1 hypothetical protein -
  EGX72_RS09110 (EGX72_09100) - 1715532..1716401 (-) 870 WP_123957766.1 phage replisome organizer N-terminal domain-containing protein -
  EGX72_RS09115 (EGX72_09105) - 1716412..1716636 (-) 225 WP_000431178.1 hypothetical protein -
  EGX72_RS09120 (EGX72_09110) - 1716774..1717004 (-) 231 WP_000879943.1 hypothetical protein -
  EGX72_RS09130 (EGX72_09120) - 1717309..1718058 (-) 750 WP_001072518.1 phage antirepressor Ant -
  EGX72_RS09135 (EGX72_09125) - 1718126..1718317 (-) 192 WP_001183891.1 helix-turn-helix transcriptional regulator -
  EGX72_RS09140 (EGX72_09130) - 1718369..1719175 (+) 807 WP_000573030.1 DUF4393 domain-containing protein -
  EGX72_RS09145 (EGX72_09135) - 1719158..1719346 (-) 189 WP_000394501.1 hypothetical protein -
  EGX72_RS09150 (EGX72_09140) - 1719376..1719534 (-) 159 WP_001104154.1 hypothetical protein -
  EGX72_RS09155 (EGX72_09145) - 1719593..1719817 (+) 225 WP_001107539.1 DUF2188 domain-containing protein -
  EGX72_RS09160 (EGX72_09150) - 1719814..1719957 (-) 144 WP_000392846.1 hypothetical protein -
  EGX72_RS09165 (EGX72_09155) - 1720318..1721115 (+) 798 WP_000550055.1 S24 family peptidase -
  EGX72_RS09170 (EGX72_09160) - 1721117..1721674 (+) 558 WP_000891067.1 GTP pyrophosphokinase -
  EGX72_RS09175 (EGX72_09165) - 1721777..1721980 (+) 204 WP_000505363.1 hypothetical protein -
  EGX72_RS09180 (EGX72_09170) - 1722103..1723182 (+) 1080 WP_000264736.1 site-specific integrase -
  EGX72_RS09190 (EGX72_09180) rplS 1723407..1723754 (-) 348 WP_001068667.1 50S ribosomal protein L19 -
  EGX72_RS09195 (EGX72_09185) - 1723937..1724738 (-) 802 Protein_1714 IS5 family transposase -
  EGX72_RS09200 (EGX72_09190) - 1725191..1726387 (-) 1197 WP_000595708.1 voltage-gated chloride channel family protein -
  EGX72_RS09205 (EGX72_09195) - 1726380..1726655 (-) 276 WP_000418127.1 chorismate mutase -
  EGX72_RS09210 (EGX72_09200) - 1726732..1727175 (-) 444 WP_001162136.1 flavodoxin -

Sequence

Protein


Download         Length: 59 a.a.        Molecular weight: 6842.78 Da        Isoelectric Point: 4.3085

>NTDB_id=325890 EGX72_RS08865 WP_000965642.1 1684851..1685030(-) (prx) [Streptococcus sp. FDAARGOS_521]
MLYIDEFKEAIDKGYISGNTVAIVRKNGKIFDYVLPHEEVRDDEVVTVESVEEVLRELK

Nucleotide


Download         Length: 180 bp        

>NTDB_id=325890 EGX72_RS08865 WP_000965642.1 1684851..1685030(-) (prx) [Streptococcus sp. FDAARGOS_521]
ATGTTATATATAGATGAGTTTAAAGAAGCGATTGATAAAGGCTATATTTCAGGGAACACAGTAGCGATAGTGCGTAAAAA
CGGAAAGATATTTGATTATGTGTTGCCGCACGAGGAAGTGAGAGATGATGAAGTTGTGACAGTTGAGAGTGTAGAAGAGG
TGTTGAGGGAATTGAAGTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  prx Streptococcus pyogenes MGAS315

77.586

98.305

0.763
  prx Streptococcus pyogenes MGAS8232

74.138

98.305

0.729
  prx Streptococcus pyogenes MGAS315

68.966

98.305

0.678
  prx Streptococcus pyogenes MGAS315

93.023

72.881

0.678
  prx Streptococcus pyogenes MGAS315

67.241

98.305

0.661
  prx Streptococcus pyogenes MGAS315

78.049

69.492

0.542
  prx Streptococcus pyogenes MGAS315

76.19

71.186

0.542

Multiple sequence alignment