Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGX78_RS07255 | Genome accession | NZ_CP033767 |
| Coordinates | 1408728..1408907 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain FDAARGOS_534 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1408728..1449345 | 1408728..1408907 | within | 0 |
Gene organization within MGE regions
Location: 1408728..1449345
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGX78_RS07255 (EGX78_07260) | prx | 1408728..1408907 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| EGX78_RS07260 (EGX78_07265) | sda1 | 1409146..1410318 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| EGX78_RS07265 (EGX78_07270) | - | 1410434..1411630 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| EGX78_RS07270 (EGX78_07275) | - | 1411741..1411926 (-) | 186 | WP_002988802.1 | holin | - |
| EGX78_RS07275 (EGX78_07280) | - | 1411923..1412222 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| EGX78_RS07280 (EGX78_07285) | - | 1412233..1412853 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| EGX78_RS07285 (EGX78_07290) | - | 1412856..1413017 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| EGX78_RS07290 (EGX78_07295) | - | 1413026..1414933 (-) | 1908 | WP_002988792.1 | gp58-like family protein | - |
| EGX78_RS07295 (EGX78_07300) | - | 1414944..1415579 (-) | 636 | WP_002988442.1 | hypothetical protein | - |
| EGX78_RS07300 (EGX78_07305) | - | 1415579..1416634 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| EGX78_RS07305 (EGX78_07310) | - | 1416631..1418613 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| EGX78_RS07310 (EGX78_07315) | - | 1418623..1419465 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| EGX78_RS07315 (EGX78_07320) | - | 1419477..1423859 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| EGX78_RS07320 (EGX78_07325) | - | 1423874..1424107 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| EGX78_RS07325 (EGX78_07330) | - | 1424182..1424637 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| EGX78_RS07330 (EGX78_07335) | - | 1424691..1425290 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| EGX78_RS07335 (EGX78_07340) | - | 1425302..1425661 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| EGX78_RS07340 (EGX78_07345) | - | 1425665..1426009 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EGX78_RS07345 (EGX78_07350) | - | 1426006..1426284 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| EGX78_RS07350 (EGX78_07355) | - | 1426295..1426651 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| EGX78_RS07355 (EGX78_07360) | - | 1426663..1427550 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| EGX78_RS07360 (EGX78_07365) | - | 1427563..1428132 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| EGX78_RS07365 (EGX78_07370) | - | 1428288..1428554 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| EGX78_RS07370 (EGX78_07375) | - | 1428557..1428745 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| EGX78_RS07375 (EGX78_07380) | - | 1428776..1430221 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| EGX78_RS07380 (EGX78_07385) | - | 1430181..1431713 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| EGX78_RS07385 (EGX78_07390) | - | 1431729..1433006 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| EGX78_RS07390 (EGX78_07395) | - | 1432996..1433448 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| EGX78_RS07395 (EGX78_07400) | - | 1433538..1433954 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| EGX78_RS07400 (EGX78_07405) | - | 1433951..1434142 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| EGX78_RS07405 (EGX78_07410) | - | 1434132..1434983 (-) | 852 | WP_002988740.1 | site-specific DNA-methyltransferase | - |
| EGX78_RS07410 (EGX78_07415) | - | 1434992..1435258 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| EGX78_RS09495 | - | 1435255..1435422 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| EGX78_RS07415 (EGX78_07420) | - | 1435423..1436745 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| EGX78_RS07420 (EGX78_07425) | - | 1436742..1437017 (-) | 276 | WP_032461521.1 | VRR-NUC domain-containing protein | - |
| EGX78_RS07425 (EGX78_07430) | - | 1437404..1439788 (-) | 2385 | WP_123949447.1 | phage/plasmid primase, P4 family | - |
| EGX78_RS07430 (EGX78_07435) | - | 1439793..1441715 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| EGX78_RS07435 (EGX78_07440) | - | 1441758..1442315 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| EGX78_RS07440 (EGX78_07445) | - | 1442326..1442724 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| EGX78_RS07445 (EGX78_07450) | - | 1442728..1443882 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| EGX78_RS07450 (EGX78_07455) | - | 1443882..1444181 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| EGX78_RS07455 (EGX78_07460) | - | 1444269..1444472 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| EGX78_RS07460 (EGX78_07465) | - | 1444618..1445004 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| EGX78_RS07465 (EGX78_07470) | - | 1445001..1445204 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| EGX78_RS07470 (EGX78_07475) | - | 1445197..1445367 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| EGX78_RS07475 (EGX78_07480) | - | 1445364..1445639 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| EGX78_RS07480 (EGX78_07485) | - | 1445701..1445916 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| EGX78_RS07485 (EGX78_07490) | - | 1445964..1446377 (+) | 414 | WP_032461522.1 | hypothetical protein | - |
| EGX78_RS09500 | - | 1446362..1446514 (-) | 153 | WP_011527730.1 | hypothetical protein | - |
| EGX78_RS07490 (EGX78_07495) | - | 1446840..1447190 (+) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| EGX78_RS07495 (EGX78_07500) | - | 1447204..1447587 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EGX78_RS07500 (EGX78_07505) | - | 1447598..1448149 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| EGX78_RS07505 (EGX78_07510) | - | 1448266..1449345 (+) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=325525 EGX78_RS07255 WP_002988813.1 1408728..1408907(-) (prx) [Streptococcus pyogenes strain FDAARGOS_534]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=325525 EGX78_RS07255 WP_002988813.1 1408728..1408907(-) (prx) [Streptococcus pyogenes strain FDAARGOS_534]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |