Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EGC57_RS04050 | Genome accession | NZ_CP033621 |
| Coordinates | 766462..766650 (+) | Length | 62 a.a. |
| NCBI ID | WP_011528571.1 | Uniprot ID | A0A660A3N3 |
| Organism | Streptococcus pyogenes strain M75 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 727605..773073 | 766462..766650 | within | 0 |
Gene organization within MGE regions
Location: 727605..773073
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EGC57_RS03790 (EGC57_03800) | - | 727605..728198 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| EGC57_RS03795 (EGC57_03805) | rfbB | 728442..729482 (+) | 1041 | WP_076639686.1 | dTDP-glucose 4,6-dehydratase | - |
| EGC57_RS03800 (EGC57_03810) | - | 729565..730704 (-) | 1140 | WP_011528538.1 | site-specific integrase | - |
| EGC57_RS03805 (EGC57_03815) | - | 730826..731512 (-) | 687 | WP_011528539.1 | hypothetical protein | - |
| EGC57_RS09515 | - | 731683..731835 (-) | 153 | WP_011054825.1 | hypothetical protein | - |
| EGC57_RS03810 (EGC57_03820) | - | 731846..732223 (-) | 378 | WP_011054824.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EGC57_RS03815 (EGC57_03825) | - | 732207..732566 (-) | 360 | WP_011528540.1 | helix-turn-helix transcriptional regulator | - |
| EGC57_RS03820 (EGC57_03830) | - | 732755..732973 (+) | 219 | WP_009881062.1 | helix-turn-helix transcriptional regulator | - |
| EGC57_RS03825 (EGC57_03835) | - | 733068..733319 (+) | 252 | WP_011528542.1 | hypothetical protein | - |
| EGC57_RS09805 | - | 733350..733484 (+) | 135 | WP_011528543.1 | hypothetical protein | - |
| EGC57_RS03830 (EGC57_03840) | - | 733500..733814 (+) | 315 | WP_011528544.1 | helix-turn-helix transcriptional regulator | - |
| EGC57_RS03835 (EGC57_03845) | - | 734041..734523 (+) | 483 | WP_011528545.1 | siphovirus Gp157 family protein | - |
| EGC57_RS03840 (EGC57_03850) | - | 734524..735204 (+) | 681 | WP_002995975.1 | AAA family ATPase | - |
| EGC57_RS03845 (EGC57_03855) | - | 735306..736535 (+) | 1230 | WP_011528546.1 | DEAD/DEAH box helicase | - |
| EGC57_RS03850 (EGC57_03860) | - | 736551..737009 (+) | 459 | WP_002995969.1 | DUF669 domain-containing protein | - |
| EGC57_RS03855 (EGC57_03865) | - | 737012..737824 (+) | 813 | WP_030126642.1 | bifunctional DNA primase/polymerase | - |
| EGC57_RS03860 (EGC57_03870) | - | 737814..739295 (+) | 1482 | WP_020905118.1 | DNA primase family protein | - |
| EGC57_RS03865 (EGC57_03875) | - | 739540..739860 (+) | 321 | WP_002995960.1 | VRR-NUC domain-containing protein | - |
| EGC57_RS03870 (EGC57_03880) | - | 739844..740200 (+) | 357 | WP_011018138.1 | hypothetical protein | - |
| EGC57_RS09850 (EGC57_03885) | - | 740197..740448 (+) | 252 | WP_011528549.1 | hypothetical protein | - |
| EGC57_RS03880 (EGC57_03890) | - | 740442..740726 (+) | 285 | WP_011017568.1 | DUF3310 domain-containing protein | - |
| EGC57_RS03885 (EGC57_03895) | - | 740723..740992 (+) | 270 | WP_002987593.1 | hypothetical protein | - |
| EGC57_RS03890 (EGC57_03900) | - | 741002..741406 (+) | 405 | WP_011054753.1 | YopX family protein | - |
| EGC57_RS09520 | - | 741403..741573 (+) | 171 | WP_011054752.1 | hypothetical protein | - |
| EGC57_RS03895 (EGC57_03905) | - | 741570..742076 (+) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| EGC57_RS09525 | - | 742073..742243 (+) | 171 | WP_164997036.1 | hypothetical protein | - |
| EGC57_RS03900 (EGC57_03910) | - | 742517..742957 (+) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EGC57_RS03905 (EGC57_03915) | - | 743105..743485 (+) | 381 | WP_011285571.1 | hypothetical protein | - |
| EGC57_RS03910 (EGC57_03920) | - | 743475..744749 (+) | 1275 | WP_021299302.1 | PBSX family phage terminase large subunit | - |
| EGC57_RS03915 (EGC57_03925) | - | 744749..746074 (+) | 1326 | WP_011528552.1 | phage portal protein | - |
| EGC57_RS03920 (EGC57_03930) | - | 746043..746951 (+) | 909 | WP_011528553.1 | minor capsid protein | - |
| EGC57_RS03925 (EGC57_03935) | - | 746958..747188 (+) | 231 | WP_011528554.1 | hypothetical protein | - |
| EGC57_RS03930 (EGC57_03940) | - | 747300..747869 (+) | 570 | WP_021299309.1 | DUF4355 domain-containing protein | - |
| EGC57_RS03935 (EGC57_03945) | - | 747888..748778 (+) | 891 | WP_009880261.1 | hypothetical protein | - |
| EGC57_RS03940 (EGC57_03950) | - | 748790..749083 (+) | 294 | WP_011528557.1 | HeH/LEM domain-containing protein | - |
| EGC57_RS03945 (EGC57_03955) | - | 749097..749441 (+) | 345 | WP_011528558.1 | hypothetical protein | - |
| EGC57_RS03950 (EGC57_03960) | - | 749438..749749 (+) | 312 | WP_011528559.1 | hypothetical protein | - |
| EGC57_RS03955 (EGC57_03965) | - | 749746..750141 (+) | 396 | WP_011528560.1 | hypothetical protein | - |
| EGC57_RS03960 (EGC57_03970) | - | 750143..750553 (+) | 411 | WP_011528561.1 | DUF5072 family protein | - |
| EGC57_RS03965 (EGC57_03975) | - | 750565..751071 (+) | 507 | WP_079890482.1 | phage major tail protein, TP901-1 family | - |
| EGC57_RS03970 (EGC57_03980) | - | 751084..751401 (+) | 318 | WP_011528563.1 | hypothetical protein | - |
| EGC57_RS03975 (EGC57_03985) | - | 751374..751832 (+) | 459 | WP_011528564.1 | hypothetical protein | - |
| EGC57_RS03980 (EGC57_03990) | - | 751825..753630 (+) | 1806 | WP_011528565.1 | tail protein | - |
| EGC57_RS03985 (EGC57_03995) | - | 753631..755115 (+) | 1485 | WP_011528566.1 | distal tail protein Dit | - |
| EGC57_RS03990 (EGC57_04000) | - | 755116..758565 (+) | 3450 | WP_050336170.1 | glucosaminidase domain-containing protein | - |
| EGC57_RS03995 (EGC57_04005) | - | 758570..760432 (+) | 1863 | WP_011528568.1 | DUF859 family phage minor structural protein | - |
| EGC57_RS04000 (EGC57_04010) | - | 760443..760790 (+) | 348 | WP_009880247.1 | DUF1366 domain-containing protein | - |
| EGC57_RS09810 | - | 760804..760926 (+) | 123 | WP_015055953.1 | hypothetical protein | - |
| EGC57_RS04005 (EGC57_04015) | - | 760940..761263 (+) | 324 | WP_015055952.1 | hypothetical protein | - |
| EGC57_RS04010 (EGC57_04020) | - | 761263..761595 (+) | 333 | WP_011054798.1 | phage holin | - |
| EGC57_RS04015 (EGC57_04025) | - | 761597..762361 (+) | 765 | WP_011054797.1 | CHAP domain-containing protein | - |
| EGC57_RS04020 (EGC57_04030) | - | 762373..762975 (+) | 603 | WP_011054796.1 | hypothetical protein | - |
| EGC57_RS04025 (EGC57_04035) | - | 762986..763759 (+) | 774 | WP_011528569.1 | hypothetical protein | - |
| EGC57_RS04030 (EGC57_04040) | - | 763769..763990 (+) | 222 | WP_009880241.1 | hypothetical protein | - |
| EGC57_RS04035 (EGC57_04045) | - | 763990..764649 (+) | 660 | WP_011528570.1 | hypothetical protein | - |
| EGC57_RS04040 (EGC57_04050) | - | 764718..765152 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| EGC57_RS04045 (EGC57_04055) | sda3 | 765424..766224 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| EGC57_RS04050 (EGC57_04060) | prx | 766462..766650 (+) | 189 | WP_011528571.1 | hypothetical protein | Regulator |
| EGC57_RS04055 (EGC57_04065) | - | 767058..767534 (+) | 477 | WP_002984880.1 | 8-oxo-dGTP diphosphatase | - |
| EGC57_RS04060 (EGC57_04070) | - | 767592..768773 (+) | 1182 | WP_038432925.1 | AI-2E family transporter | - |
| EGC57_RS04065 (EGC57_04075) | - | 768763..770010 (+) | 1248 | WP_032460151.1 | tetratricopeptide repeat protein | - |
| EGC57_RS04070 (EGC57_04080) | fbp54 | 770069..771721 (-) | 1653 | WP_076639624.1 | Rqc2 family fibronectin-binding protein Fbp54 | - |
| EGC57_RS04075 (EGC57_04085) | trpX | 772075..773073 (+) | 999 | WP_076639625.1 | tryptophan ABC transporter substrate-binding protein | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7224.11 Da Isoelectric Point: 4.0606
>NTDB_id=324482 EGC57_RS04050 WP_011528571.1 766462..766650(+) (prx) [Streptococcus pyogenes strain M75]
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
MLTYDEFKQAIDREYITGDTVMIVRKNGQIFDYVLPHEEVRNGEVVTIERISDVMAELSESE
Nucleotide
Download Length: 189 bp
>NTDB_id=324482 EGC57_RS04050 WP_011528571.1 766462..766650(+) (prx) [Streptococcus pyogenes strain M75]
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
ATGCTAACATATGACGAGTTTAAGCAAGCAATCGACCGTGAATATATCACAGGAGACACAGTTATGATCGTGCGCAAGAA
CGGACAGATTTTTGATTATGTGTTGCCGCATGAAGAAGTGAGAAATGGGGAAGTTGTGACAATCGAGCGGATATCAGATG
TTATGGCAGAACTTTCTGAGTCTGAATAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
76.667 |
96.774 |
0.742 |
| prx | Streptococcus pyogenes MGAS315 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS8232 |
76.271 |
95.161 |
0.726 |
| prx | Streptococcus pyogenes MGAS315 |
71.667 |
96.774 |
0.694 |
| prx | Streptococcus pyogenes MGAS315 |
90.698 |
69.355 |
0.629 |
| prx | Streptococcus pyogenes MGAS315 |
85.366 |
66.129 |
0.565 |
| prx | Streptococcus pyogenes MGAS315 |
76.19 |
67.742 |
0.516 |