Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | EFV54_RS05430 | Genome accession | NZ_CP033607 |
| Coordinates | 1043169..1043621 (+) | Length | 150 a.a. |
| NCBI ID | WP_010905690.1 | Uniprot ID | A0AAC9R1D2 |
| Organism | Lactococcus lactis strain IL1403 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1032978..1084509 | 1043169..1043621 | within | 0 |
Gene organization within MGE regions
Location: 1032978..1084509
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFV54_RS05355 (EFV54_05355) | - | 1032978..1033634 (+) | 657 | WP_010905677.1 | phosphatase PAP2 family protein | - |
| EFV54_RS05360 (EFV54_05360) | glmS | 1033815..1035632 (+) | 1818 | WP_010905678.1 | glutamine--fructose-6-phosphate transaminase (isomerizing) | - |
| EFV54_RS05365 (EFV54_05365) | radC | 1035763..1036443 (+) | 681 | WP_003131898.1 | DNA repair protein RadC | - |
| EFV54_RS05370 (EFV54_05370) | - | 1036642..1037766 (-) | 1125 | WP_010905679.1 | site-specific integrase | - |
| EFV54_RS05375 (EFV54_05375) | - | 1037889..1038434 (-) | 546 | WP_010905680.1 | PH domain-containing protein | - |
| EFV54_RS05380 (EFV54_05380) | - | 1038491..1038928 (-) | 438 | WP_010905681.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EFV54_RS05385 (EFV54_05385) | - | 1038925..1039467 (-) | 543 | WP_010905682.1 | helix-turn-helix domain-containing protein | - |
| EFV54_RS05390 (EFV54_05390) | - | 1039635..1039853 (+) | 219 | WP_010905683.1 | DUF739 family protein | - |
| EFV54_RS05395 (EFV54_05395) | - | 1039890..1040633 (+) | 744 | WP_010905684.1 | ORF6C domain-containing protein | - |
| EFV54_RS05400 (EFV54_05400) | - | 1040646..1040981 (+) | 336 | WP_003131910.1 | DUF771 domain-containing protein | - |
| EFV54_RS05405 (EFV54_05405) | - | 1041119..1041313 (+) | 195 | WP_010905685.1 | hypothetical protein | - |
| EFV54_RS05410 (EFV54_05410) | - | 1041310..1041585 (-) | 276 | WP_023349243.1 | hypothetical protein | - |
| EFV54_RS05415 (EFV54_05415) | - | 1041688..1041903 (+) | 216 | WP_015966756.1 | DUF1408 domain-containing protein | - |
| EFV54_RS05420 (EFV54_05420) | - | 1042019..1042537 (+) | 519 | WP_010905688.1 | host-nuclease inhibitor Gam family protein | - |
| EFV54_RS05425 (EFV54_05425) | - | 1042546..1043169 (+) | 624 | WP_010905689.1 | DUF1071 domain-containing protein | - |
| EFV54_RS05430 (EFV54_05430) | ssb | 1043169..1043621 (+) | 453 | WP_010905690.1 | single-stranded DNA-binding protein | Machinery gene |
| EFV54_RS05435 (EFV54_05435) | - | 1043746..1044528 (+) | 783 | WP_015966758.1 | phage replisome organiser protein | - |
| EFV54_RS05440 (EFV54_05440) | - | 1044528..1045253 (+) | 726 | WP_015966759.1 | hypothetical protein | - |
| EFV54_RS05445 (EFV54_05445) | - | 1045250..1045639 (+) | 390 | WP_002819817.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EFV54_RS05450 (EFV54_05450) | - | 1045642..1045836 (+) | 195 | WP_010905693.1 | hypothetical protein | - |
| EFV54_RS05455 (EFV54_05455) | - | 1045829..1046068 (+) | 240 | WP_031297271.1 | DUF1031 family protein | - |
| EFV54_RS05460 (EFV54_05460) | - | 1046186..1046446 (+) | 261 | WP_223203848.1 | hypothetical protein | - |
| EFV54_RS05465 (EFV54_05465) | - | 1046468..1046647 (+) | 180 | WP_010905696.1 | DUF1497 domain-containing protein | - |
| EFV54_RS05470 (EFV54_05470) | - | 1046637..1047206 (+) | 570 | WP_010905697.1 | DUF658 family protein | - |
| EFV54_RS12180 | - | 1047213..1047356 (-) | 144 | WP_153916742.1 | hypothetical protein | - |
| EFV54_RS05475 (EFV54_05475) | - | 1047400..1047606 (+) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| EFV54_RS05480 (EFV54_05480) | - | 1047599..1047871 (+) | 273 | WP_010905357.1 | hypothetical protein | - |
| EFV54_RS05485 (EFV54_05485) | - | 1047874..1048422 (+) | 549 | WP_223203841.1 | DUF1642 domain-containing protein | - |
| EFV54_RS05490 (EFV54_05490) | - | 1048419..1048838 (+) | 420 | WP_010905698.1 | dUTP diphosphatase | - |
| EFV54_RS05495 (EFV54_05495) | - | 1048841..1049338 (+) | 498 | WP_010905699.1 | hypothetical protein | - |
| EFV54_RS05500 (EFV54_05500) | - | 1049331..1049675 (+) | 345 | WP_223203818.1 | hypothetical protein | - |
| EFV54_RS05505 (EFV54_05505) | - | 1049697..1049861 (+) | 165 | WP_010905701.1 | hypothetical protein | - |
| EFV54_RS05510 (EFV54_05510) | - | 1049908..1050093 (+) | 186 | WP_010905702.1 | hypothetical protein | - |
| EFV54_RS05515 (EFV54_05515) | - | 1050135..1050308 (+) | 174 | WP_010905703.1 | DUF1660 domain-containing protein | - |
| EFV54_RS05520 (EFV54_05520) | - | 1050309..1050608 (+) | 300 | WP_010905704.1 | hypothetical protein | - |
| EFV54_RS05525 (EFV54_05525) | - | 1050605..1050787 (+) | 183 | WP_010905705.1 | hypothetical protein | - |
| EFV54_RS05535 (EFV54_05535) | - | 1051151..1051444 (+) | 294 | WP_010905707.1 | DUF1359 domain-containing protein | - |
| EFV54_RS05540 (EFV54_05540) | - | 1051522..1051923 (+) | 402 | WP_010905708.1 | RinA family protein | - |
| EFV54_RS05545 (EFV54_05545) | - | 1052187..1052486 (+) | 300 | WP_023349146.1 | HNH endonuclease | - |
| EFV54_RS05550 (EFV54_05550) | - | 1052578..1052946 (+) | 369 | WP_010905710.1 | P27 family phage terminase small subunit | - |
| EFV54_RS05555 (EFV54_05555) | - | 1052930..1054708 (+) | 1779 | WP_010905711.1 | terminase large subunit | - |
| EFV54_RS05560 (EFV54_05560) | - | 1054722..1055927 (+) | 1206 | WP_010905712.1 | phage portal protein | - |
| EFV54_RS05565 (EFV54_05565) | - | 1055942..1056538 (+) | 597 | WP_010905713.1 | HK97 family phage prohead protease | - |
| EFV54_RS05570 (EFV54_05570) | - | 1056510..1057703 (+) | 1194 | WP_010905714.1 | phage major capsid protein | - |
| EFV54_RS05575 (EFV54_05575) | - | 1057758..1058615 (+) | 858 | WP_010905715.1 | hypothetical protein | - |
| EFV54_RS05580 (EFV54_05580) | - | 1058608..1058889 (+) | 282 | WP_010905716.1 | hypothetical protein | - |
| EFV54_RS05585 (EFV54_05585) | - | 1058876..1059193 (+) | 318 | WP_010905717.1 | phage head closure protein | - |
| EFV54_RS05590 (EFV54_05590) | - | 1059183..1059554 (+) | 372 | WP_010905718.1 | HK97 gp10 family phage protein | - |
| EFV54_RS05595 (EFV54_05595) | - | 1059551..1059868 (+) | 318 | WP_010905719.1 | hypothetical protein | - |
| EFV54_RS05600 (EFV54_05600) | - | 1059886..1060494 (+) | 609 | WP_010905720.1 | major tail protein | - |
| EFV54_RS05605 (EFV54_05605) | - | 1060504..1060863 (+) | 360 | WP_010905721.1 | hypothetical protein | - |
| EFV54_RS05615 (EFV54_05615) | - | 1061080..1063341 (+) | 2262 | WP_010905723.1 | phage tail tape measure protein | - |
| EFV54_RS05620 (EFV54_05620) | - | 1063342..1064091 (+) | 750 | WP_010905724.1 | hypothetical protein | - |
| EFV54_RS05625 (EFV54_05625) | - | 1064088..1066772 (+) | 2685 | WP_023349144.1 | phage tail spike protein | - |
| EFV54_RS05630 (EFV54_05630) | - | 1066785..1068386 (+) | 1602 | WP_010905726.1 | DUF2479 domain-containing protein | - |
| EFV54_RS05635 (EFV54_05635) | - | 1068379..1069209 (+) | 831 | WP_010905727.1 | hypothetical protein | - |
| EFV54_RS05645 (EFV54_05645) | - | 1069662..1070000 (+) | 339 | WP_010905729.1 | hypothetical protein | - |
| EFV54_RS05650 (EFV54_05650) | - | 1070002..1070229 (+) | 228 | WP_010905730.1 | hypothetical protein | - |
| EFV54_RS05655 (EFV54_05655) | - | 1070255..1070479 (+) | 225 | WP_010905731.1 | hemolysin XhlA family protein | - |
| EFV54_RS05660 (EFV54_05660) | - | 1070492..1070779 (+) | 288 | WP_010905732.1 | phage holin | - |
| EFV54_RS05665 (EFV54_05665) | - | 1070779..1071558 (+) | 780 | WP_010905733.1 | peptidoglycan amidohydrolase family protein | - |
| EFV54_RS05680 (EFV54_05680) | - | 1072060..1072710 (-) | 651 | WP_003132737.1 | redox-sensing transcriptional repressor Rex | - |
| EFV54_RS05685 (EFV54_05685) | - | 1072935..1073327 (+) | 393 | WP_003132739.1 | Spx/MgsR family RNA polymerase-binding regulatory protein | - |
| EFV54_RS05690 (EFV54_05690) | - | 1073505..1075412 (+) | 1908 | WP_021214548.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| EFV54_RS05695 (EFV54_05695) | - | 1075601..1076401 (+) | 801 | WP_010905736.1 | hypothetical protein | - |
| EFV54_RS05700 (EFV54_05700) | - | 1076403..1076768 (+) | 366 | WP_003132744.1 | hypothetical protein | - |
| EFV54_RS05705 (EFV54_05705) | - | 1077284..1077469 (+) | 186 | WP_003132749.1 | hypothetical protein | - |
| EFV54_RS05710 (EFV54_05710) | - | 1077644..1078501 (+) | 858 | WP_010905739.1 | XRE/MutR family transcriptional regulator | - |
| EFV54_RS05715 (EFV54_05715) | - | 1078748..1079479 (+) | 732 | WP_003132752.1 | hypothetical protein | - |
| EFV54_RS05720 (EFV54_05720) | - | 1079492..1079671 (+) | 180 | WP_012897690.1 | hypothetical protein | - |
| EFV54_RS05725 (EFV54_05725) | - | 1079705..1079893 (+) | 189 | WP_017864422.1 | hypothetical protein | - |
| EFV54_RS12185 | - | 1079958..1080119 (+) | 162 | WP_021214547.1 | hypothetical protein | - |
| EFV54_RS12570 | - | 1080592..1080720 (-) | 129 | WP_003132757.1 | hypothetical protein | - |
| EFV54_RS05735 (EFV54_05735) | pyrE | 1080701..1081330 (+) | 630 | WP_003132758.1 | orotate phosphoribosyltransferase | - |
| EFV54_RS05740 (EFV54_05740) | - | 1081485..1082756 (+) | 1272 | WP_031296484.1 | dihydroorotase | - |
| EFV54_RS05745 (EFV54_05745) | - | 1083163..1083831 (+) | 669 | WP_010905741.1 | DnaD domain-containing protein | - |
| EFV54_RS05750 (EFV54_05750) | nth | 1083853..1084509 (+) | 657 | WP_003130627.1 | endonuclease III | - |
Sequence
Protein
Download Length: 150 a.a. Molecular weight: 16643.67 Da Isoelectric Point: 8.9728
>NTDB_id=324365 EFV54_RS05430 WP_010905690.1 1043169..1043621(+) (ssb) [Lactococcus lactis strain IL1403]
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
MINNVVLVGRLTRDPELRHTPQNQAVGTFGLAVNRQFKNANGEREADFINCVIWRQQAENLAKFAKKGALIGITGRIQTR
NYENQQGQKVYVTEVVADTFQMLESNKTQGQQTSKPQAQNKKPQAPDPFKAPAADPFAGGTEISDDDLPF
Nucleotide
Download Length: 453 bp
>NTDB_id=324365 EFV54_RS05430 WP_010905690.1 1043169..1043621(+) (ssb) [Lactococcus lactis strain IL1403]
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
ATGATTAATAATGTTGTATTAGTAGGTCGCTTAACTCGTGACCCTGAACTTAGACATACACCACAGAACCAAGCAGTAGG
TACATTTGGATTAGCTGTAAATCGCCAGTTTAAAAATGCGAATGGCGAACGTGAGGCTGATTTCATTAACTGCGTTATTT
GGCGACAACAAGCCGAAAATTTAGCTAAGTTTGCTAAAAAAGGAGCTTTGATTGGAATAACTGGACGGATTCAAACAAGG
AACTATGAGAACCAACAAGGACAAAAAGTTTATGTTACCGAAGTTGTTGCAGATACTTTCCAAATGCTAGAAAGCAATAA
AACACAAGGTCAGCAAACAAGTAAACCGCAAGCTCAAAATAAAAAGCCACAAGCACCAGACCCTTTTAAAGCTCCTGCTG
CTGATCCATTTGCTGGTGGTACTGAAATTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.14 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.607 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
69.333 |
0.407 |
| ssb | Neisseria meningitidis MC58 |
34.302 |
100 |
0.393 |
| ssb | Neisseria gonorrhoeae MS11 |
33.721 |
100 |
0.387 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
52.381 |
70 |
0.367 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.429 |
70 |
0.36 |