Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EB816_RS07805 | Genome accession | NZ_CP033337 |
| Coordinates | 1511977..1512156 (-) | Length | 59 a.a. |
| NCBI ID | WP_002988813.1 | Uniprot ID | Q5YAB1 |
| Organism | Streptococcus pyogenes strain TSPY453 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1511977..1552596 | 1511977..1512156 | within | 0 |
Gene organization within MGE regions
Location: 1511977..1552596
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB816_RS07805 (EB816_07805) | prx | 1511977..1512156 (-) | 180 | WP_002988813.1 | hypothetical protein | Regulator |
| EB816_RS07810 (EB816_07810) | sda1 | 1512395..1513567 (+) | 1173 | WP_002988811.1 | streptodornase Sda1 | - |
| EB816_RS07815 (EB816_07815) | - | 1513683..1514879 (-) | 1197 | WP_002988807.1 | glucosaminidase domain-containing protein | - |
| EB816_RS07820 (EB816_07820) | - | 1514990..1515175 (-) | 186 | WP_021341107.1 | holin | - |
| EB816_RS07825 (EB816_07825) | - | 1515172..1515471 (-) | 300 | WP_002988799.1 | hypothetical protein | - |
| EB816_RS07830 (EB816_07830) | - | 1515482..1516102 (-) | 621 | WP_002988797.1 | hypothetical protein | - |
| EB816_RS07835 (EB816_07835) | - | 1516105..1516266 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| EB816_RS07840 (EB816_07840) | - | 1516275..1518182 (-) | 1908 | WP_021341125.1 | gp58-like family protein | - |
| EB816_RS07845 (EB816_07845) | - | 1518193..1518828 (-) | 636 | WP_021341117.1 | hypothetical protein | - |
| EB816_RS07850 (EB816_07850) | - | 1518828..1519883 (-) | 1056 | WP_002988439.1 | hypothetical protein | - |
| EB816_RS07855 (EB816_07855) | - | 1519880..1521862 (-) | 1983 | WP_002988790.1 | phage tail protein | - |
| EB816_RS07860 (EB816_07860) | - | 1521872..1522714 (-) | 843 | WP_002988788.1 | phage tail family protein | - |
| EB816_RS07865 (EB816_07865) | - | 1522726..1527108 (-) | 4383 | WP_002988786.1 | tape measure protein | - |
| EB816_RS07870 (EB816_07870) | - | 1527123..1527356 (-) | 234 | WP_002983445.1 | hypothetical protein | - |
| EB816_RS07875 (EB816_07875) | - | 1527431..1527886 (-) | 456 | WP_002983443.1 | tail assembly chaperone | - |
| EB816_RS07880 (EB816_07880) | - | 1527940..1528539 (-) | 600 | WP_002988784.1 | phage major tail protein, TP901-1 family | - |
| EB816_RS07885 (EB816_07885) | - | 1528551..1528910 (-) | 360 | WP_002988782.1 | hypothetical protein | - |
| EB816_RS07890 (EB816_07890) | - | 1528914..1529258 (-) | 345 | WP_002988781.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| EB816_RS07895 (EB816_07895) | - | 1529255..1529533 (-) | 279 | WP_000639437.1 | hypothetical protein | - |
| EB816_RS07900 (EB816_07900) | - | 1529544..1529900 (-) | 357 | WP_002988776.1 | phage head-tail connector protein | - |
| EB816_RS07905 (EB816_07905) | - | 1529912..1530799 (-) | 888 | WP_002988771.1 | hypothetical protein | - |
| EB816_RS07910 (EB816_07910) | - | 1530812..1531381 (-) | 570 | WP_002988768.1 | DUF4355 domain-containing protein | - |
| EB816_RS07915 (EB816_07915) | - | 1531537..1531803 (-) | 267 | WP_002988765.1 | hypothetical protein | - |
| EB816_RS07920 (EB816_07920) | - | 1531806..1531994 (-) | 189 | WP_002983423.1 | hypothetical protein | - |
| EB816_RS07925 (EB816_07925) | - | 1532025..1533470 (-) | 1446 | WP_015446273.1 | minor capsid protein | - |
| EB816_RS07930 (EB816_07930) | - | 1533430..1534962 (-) | 1533 | WP_002988758.1 | phage portal protein | - |
| EB816_RS07935 (EB816_07935) | - | 1534978..1536255 (-) | 1278 | WP_002988754.1 | PBSX family phage terminase large subunit | - |
| EB816_RS07940 (EB816_07940) | - | 1536245..1536697 (-) | 453 | WP_011106637.1 | terminase small subunit | - |
| EB816_RS07945 (EB816_07945) | - | 1536787..1537203 (-) | 417 | WP_002988747.1 | DUF722 domain-containing protein | - |
| EB816_RS07950 (EB816_07950) | - | 1537200..1537391 (-) | 192 | WP_002988743.1 | hypothetical protein | - |
| EB816_RS07955 (EB816_07955) | - | 1537542..1538171 (-) | 630 | WP_241686051.1 | site-specific DNA-methyltransferase | - |
| EB816_RS07960 (EB816_07960) | - | 1538243..1538509 (-) | 267 | WP_002988738.1 | hypothetical protein | - |
| EB816_RS10220 | - | 1538506..1538673 (-) | 168 | WP_002988735.1 | hypothetical protein | - |
| EB816_RS07965 (EB816_07965) | - | 1538674..1539996 (-) | 1323 | WP_002988733.1 | SNF2-related protein | - |
| EB816_RS07970 (EB816_07970) | - | 1539993..1540268 (-) | 276 | WP_002988730.1 | VRR-NUC domain-containing protein | - |
| EB816_RS07975 (EB816_07975) | - | 1540655..1543039 (-) | 2385 | WP_011285674.1 | phage/plasmid primase, P4 family | - |
| EB816_RS07980 (EB816_07980) | - | 1543044..1544966 (-) | 1923 | WP_002988723.1 | DNA polymerase | - |
| EB816_RS07985 (EB816_07985) | - | 1545009..1545566 (-) | 558 | WP_002988718.1 | DUF2815 family protein | - |
| EB816_RS07990 (EB816_07990) | - | 1545577..1545975 (-) | 399 | WP_002988715.1 | hypothetical protein | - |
| EB816_RS07995 (EB816_07995) | - | 1545979..1547133 (-) | 1155 | WP_002988711.1 | DUF2800 domain-containing protein | - |
| EB816_RS08000 (EB816_08000) | - | 1547133..1547432 (-) | 300 | WP_002988708.1 | hypothetical protein | - |
| EB816_RS08005 (EB816_08005) | - | 1547520..1547723 (-) | 204 | WP_002988705.1 | hypothetical protein | - |
| EB816_RS08010 (EB816_08010) | - | 1547870..1548256 (-) | 387 | WP_002988700.1 | hypothetical protein | - |
| EB816_RS08015 (EB816_08015) | - | 1548253..1548456 (-) | 204 | WP_002988697.1 | hypothetical protein | - |
| EB816_RS08020 (EB816_08020) | - | 1548449..1548619 (-) | 171 | WP_002988693.1 | hypothetical protein | - |
| EB816_RS08025 (EB816_08025) | - | 1548616..1548891 (-) | 276 | WP_002988687.1 | hypothetical protein | - |
| EB816_RS08030 (EB816_08030) | - | 1548953..1549168 (-) | 216 | WP_002988684.1 | hypothetical protein | - |
| EB816_RS08035 (EB816_08035) | - | 1549216..1549629 (+) | 414 | WP_002988681.1 | hypothetical protein | - |
| EB816_RS10225 | - | 1549610..1549765 (-) | 156 | WP_002988678.1 | hypothetical protein | - |
| EB816_RS08040 (EB816_08040) | - | 1550091..1550441 (+) | 351 | WP_002988676.1 | helix-turn-helix transcriptional regulator | - |
| EB816_RS08045 (EB816_08045) | - | 1550455..1550838 (+) | 384 | WP_002988673.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EB816_RS08050 (EB816_08050) | - | 1550849..1551400 (+) | 552 | WP_002988670.1 | hypothetical protein | - |
| EB816_RS08055 (EB816_08055) | - | 1551517..1552596 (+) | 1080 | WP_002988667.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6798.70 Da Isoelectric Point: 4.2542
>NTDB_id=323145 EB816_RS07805 WP_002988813.1 1511977..1512156(-) (prx) [Streptococcus pyogenes strain TSPY453]
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
MLTYDEFKQAIDHGYITGDTVAIVRKNGQIFDYVLPHEKVKNGEVVTDEKVEEVLMELE
Nucleotide
Download Length: 180 bp
>NTDB_id=323145 EB816_RS07805 WP_002988813.1 1511977..1512156(-) (prx) [Streptococcus pyogenes strain TSPY453]
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
ATGCTAACATACGACGAATTTAAGCAAGCAATCGACCATGGGTATATCACAGGAGACACAGTAGCGATTGTGCGCAAAAA
CGGACAGATCTTTGATTATGTGTTGCCACATGAGAAAGTAAAGAATGGAGAAGTTGTGACAGATGAAAAAGTGGAAGAAG
TGTTGATGGAATTGGAGTAA
Domains
No domain identified.
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
91.379 |
98.305 |
0.898 |
| prx | Streptococcus pyogenes MGAS315 |
87.931 |
98.305 |
0.864 |
| prx | Streptococcus pyogenes MGAS315 |
84.746 |
100 |
0.847 |
| prx | Streptococcus pyogenes MGAS315 |
74.576 |
100 |
0.746 |
| prx | Streptococcus pyogenes MGAS315 |
86.047 |
72.881 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
90.244 |
69.492 |
0.627 |
| prx | Streptococcus pyogenes MGAS315 |
80.952 |
71.186 |
0.576 |