Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | EB816_RS03250 | Genome accession | NZ_CP033337 |
| Coordinates | 594258..594437 (+) | Length | 59 a.a. |
| NCBI ID | WP_030127450.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain TSPY453 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 547666..594499 | 594258..594437 | within | 0 |
Gene organization within MGE regions
Location: 547666..594499
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EB816_RS02925 (EB816_02930) | - | 547666..548607 (-) | 942 | WP_002985305.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| EB816_RS02930 (EB816_02935) | - | 549001..549450 (+) | 450 | WP_002985303.1 | flavodoxin | - |
| EB816_RS02935 (EB816_02940) | - | 549625..549909 (+) | 285 | WP_002994052.1 | chorismate mutase | - |
| EB816_RS02940 (EB816_02945) | - | 549902..551164 (+) | 1263 | WP_050336105.1 | chloride channel protein | - |
| EB816_RS02945 (EB816_02950) | rplS | 551279..551626 (+) | 348 | WP_002985298.1 | 50S ribosomal protein L19 | - |
| EB816_RS02955 (EB816_02960) | - | 551989..553065 (-) | 1077 | WP_023612372.1 | site-specific integrase | - |
| EB816_RS02960 (EB816_02965) | - | 553184..553705 (-) | 522 | WP_023612337.1 | hypothetical protein | - |
| EB816_RS02965 (EB816_02970) | - | 553716..554093 (-) | 378 | WP_023612306.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EB816_RS02970 (EB816_02975) | - | 554077..554436 (-) | 360 | WP_023611288.1 | helix-turn-helix transcriptional regulator | - |
| EB816_RS02975 (EB816_02980) | - | 554624..554842 (+) | 219 | WP_023612341.1 | helix-turn-helix transcriptional regulator | - |
| EB816_RS02980 (EB816_02985) | - | 554942..555172 (+) | 231 | WP_023612302.1 | hypothetical protein | - |
| EB816_RS02985 (EB816_02990) | - | 555309..555527 (+) | 219 | WP_023612348.1 | hypothetical protein | - |
| EB816_RS02990 (EB816_02995) | - | 555529..555771 (+) | 243 | WP_003056170.1 | hypothetical protein | - |
| EB816_RS02995 (EB816_03000) | - | 555755..557074 (+) | 1320 | WP_030127673.1 | AAA family ATPase | - |
| EB816_RS03000 (EB816_03005) | - | 557089..558171 (+) | 1083 | WP_003056188.1 | ATP-binding protein | - |
| EB816_RS10435 | - | 558210..558344 (+) | 135 | WP_023612344.1 | hypothetical protein | - |
| EB816_RS03005 (EB816_03010) | - | 558366..558959 (+) | 594 | WP_003056185.1 | hypothetical protein | - |
| EB816_RS03010 (EB816_03015) | - | 558959..560542 (+) | 1584 | WP_080262841.1 | DEAD/DEAH box helicase | - |
| EB816_RS03015 (EB816_03020) | - | 560555..560749 (+) | 195 | WP_023612331.1 | hypothetical protein | - |
| EB816_RS03020 (EB816_03025) | - | 560772..563015 (+) | 2244 | WP_023612365.1 | AAA family ATPase | - |
| EB816_RS03025 (EB816_03030) | - | 563307..563489 (+) | 183 | WP_003059078.1 | hypothetical protein | - |
| EB816_RS03030 (EB816_03035) | - | 563482..563877 (+) | 396 | WP_023612320.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EB816_RS03035 (EB816_03040) | - | 563874..564098 (+) | 225 | WP_023612313.1 | hypothetical protein | - |
| EB816_RS03040 (EB816_03045) | - | 564101..564286 (+) | 186 | WP_023612326.1 | hypothetical protein | - |
| EB816_RS03045 (EB816_03050) | - | 564283..564534 (+) | 252 | WP_023612315.1 | hypothetical protein | - |
| EB816_RS03050 (EB816_03055) | - | 564518..564922 (+) | 405 | WP_023612304.1 | YopX family protein | - |
| EB816_RS03055 (EB816_03060) | - | 564919..565203 (+) | 285 | WP_014411870.1 | hypothetical protein | - |
| EB816_RS03060 (EB816_03065) | - | 565205..565837 (+) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| EB816_RS03065 (EB816_03070) | - | 565840..566550 (+) | 711 | WP_014411869.1 | DUF1642 domain-containing protein | - |
| EB816_RS03070 (EB816_03075) | - | 566547..566918 (+) | 372 | WP_014411868.1 | hypothetical protein | - |
| EB816_RS03075 (EB816_03080) | - | 567186..567623 (+) | 438 | WP_021340586.1 | DUF1492 domain-containing protein | - |
| EB816_RS03090 (EB816_03095) | - | 568142..568399 (-) | 258 | WP_011054748.1 | hypothetical protein | - |
| EB816_RS03095 (EB816_03100) | - | 568480..568998 (+) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| EB816_RS03100 (EB816_03105) | - | 568977..569654 (+) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| EB816_RS10245 (EB816_03110) | - | 569663..570046 (+) | 384 | WP_076639321.1 | GNAT family N-acetyltransferase | - |
| EB816_RS03110 (EB816_03115) | - | 570107..570484 (+) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| EB816_RS03115 (EB816_03120) | - | 570526..571008 (+) | 483 | WP_227874485.1 | hypothetical protein | - |
| EB816_RS03120 (EB816_03125) | - | 571091..572302 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| EB816_RS03125 (EB816_03130) | - | 572316..573818 (+) | 1503 | WP_002986832.1 | phage portal protein | - |
| EB816_RS03130 (EB816_03135) | - | 573823..575301 (+) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| EB816_RS03135 (EB816_03140) | - | 575273..575512 (+) | 240 | WP_002986829.1 | hypothetical protein | - |
| EB816_RS03140 (EB816_03145) | - | 575574..575840 (+) | 267 | WP_011054745.1 | hypothetical protein | - |
| EB816_RS03145 (EB816_03150) | - | 575966..576580 (+) | 615 | WP_011106689.1 | hypothetical protein | - |
| EB816_RS03150 (EB816_03155) | - | 576584..577402 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| EB816_RS03155 (EB816_03160) | - | 577456..577872 (+) | 417 | WP_011054743.1 | hypothetical protein | - |
| EB816_RS03160 (EB816_03165) | - | 577862..578194 (+) | 333 | WP_010922082.1 | minor capsid protein | - |
| EB816_RS03165 (EB816_03170) | - | 578194..578550 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| EB816_RS03170 (EB816_03175) | - | 578547..578945 (+) | 399 | WP_010922084.1 | minor capsid protein | - |
| EB816_RS03175 (EB816_03180) | - | 578945..579430 (+) | 486 | WP_011054741.1 | hypothetical protein | - |
| EB816_RS03180 (EB816_03185) | - | 579469..579903 (+) | 435 | WP_011054740.1 | hypothetical protein | - |
| EB816_RS03185 (EB816_03190) | - | 579907..580488 (+) | 582 | WP_011284973.1 | bacteriophage Gp15 family protein | - |
| EB816_RS03190 (EB816_03195) | - | 580478..583738 (+) | 3261 | WP_023612368.1 | tape measure protein | - |
| EB816_RS03195 (EB816_03200) | - | 583735..584451 (+) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| EB816_RS03200 (EB816_03205) | - | 584448..586595 (+) | 2148 | WP_111706021.1 | phage tail spike protein | - |
| EB816_RS03205 (EB816_03210) | - | 586592..587806 (+) | 1215 | WP_011284843.1 | hypothetical protein | - |
| EB816_RS03210 (EB816_03215) | - | 587808..588122 (+) | 315 | WP_021340983.1 | hypothetical protein | - |
| EB816_RS03215 (EB816_03220) | - | 588133..590022 (+) | 1890 | WP_023612347.1 | gp58-like family protein | - |
| EB816_RS03220 (EB816_03225) | - | 590034..590462 (+) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| EB816_RS03225 (EB816_03230) | - | 590465..591097 (+) | 633 | WP_011054443.1 | hypothetical protein | - |
| EB816_RS03230 (EB816_03235) | - | 591109..591381 (+) | 273 | WP_011017397.1 | hypothetical protein | - |
| EB816_RS03235 (EB816_03240) | - | 591378..591605 (+) | 228 | WP_011054444.1 | phage holin | - |
| EB816_RS03240 (EB816_03245) | - | 591721..592929 (+) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| EB816_RS03245 (EB816_03250) | - | 593039..594025 (-) | 987 | WP_050440680.1 | DNA/RNA non-specific endonuclease | - |
| EB816_RS03250 (EB816_03255) | prx | 594258..594437 (+) | 180 | WP_030127450.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 59 a.a. Molecular weight: 6979.01 Da Isoelectric Point: 3.8662
>NTDB_id=323129 EB816_RS03250 WP_030127450.1 594258..594437(+) (prx) [Streptococcus pyogenes strain TSPY453]
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
MLTYDEFKQAIDDGYITTDAVMIVRKNGQIFDYVLPGEEVRPWEIVIEERVAEVLMELW
Nucleotide
Download Length: 180 bp
>NTDB_id=323129 EB816_RS03250 WP_030127450.1 594258..594437(+) (prx) [Streptococcus pyogenes strain TSPY453]
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
ATGCTAACATACGACGAATTTAAGCAAGCAATTGATGACGGCTATATCACAACAGACGCAGTAATGATCGTGCGCAAGAA
CGGACAAATTTTTGATTATGTCTTGCCAGGAGAGGAAGTCAGGCCATGGGAGATTGTGATCGAGGAGAGGGTGGCGGAGG
TGTTGATGGAATTGTGGTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
81.034 |
98.305 |
0.797 |
| prx | Streptococcus pyogenes MGAS315 |
77.586 |
98.305 |
0.763 |
| prx | Streptococcus pyogenes MGAS315 |
75.862 |
98.305 |
0.746 |
| prx | Streptococcus pyogenes MGAS8232 |
70.69 |
98.305 |
0.695 |
| prx | Streptococcus pyogenes MGAS315 |
87.805 |
69.492 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
85.714 |
71.186 |
0.61 |
| prx | Streptococcus pyogenes MGAS315 |
73.171 |
69.492 |
0.508 |